BLASTX nr result
ID: Scutellaria23_contig00021445
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00021445 (383 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306075.1| predicted protein [Populus trichocarpa] gi|2... 65 4e-09 ref|NP_179197.1| pentatricopeptide repeat-containing protein [Ar... 59 3e-07 ref|XP_003537906.1| PREDICTED: pentatricopeptide repeat-containi... 55 5e-06 emb|CBI32533.3| unnamed protein product [Vitis vinifera] 55 6e-06 ref|XP_002281132.1| PREDICTED: pentatricopeptide repeat-containi... 55 6e-06 >ref|XP_002306075.1| predicted protein [Populus trichocarpa] gi|222849039|gb|EEE86586.1| predicted protein [Populus trichocarpa] Length = 498 Score = 65.5 bits (158), Expect = 4e-09 Identities = 28/48 (58%), Positives = 37/48 (77%) Frame = +3 Query: 189 VSILKHHRSKPRWSHLRSLLAAAKTNRLSPSQFSLISLQIRNNPHLVL 332 +S+L HHRSK RWSHLRSLL + L+P FSLI+L++++NPHL L Sbjct: 44 ISLLTHHRSKSRWSHLRSLLTTTTSTPLAPGHFSLITLKLKSNPHLAL 91 >ref|NP_179197.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75267579|sp|Q9XIM8.1|PP155_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g15980 gi|5306237|gb|AAD41970.1| hypothetical protein [Arabidopsis thaliana] gi|330251359|gb|AEC06453.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 498 Score = 59.3 bits (142), Expect = 3e-07 Identities = 32/50 (64%), Positives = 37/50 (74%) Frame = +3 Query: 186 AVSILKHHRSKPRWSHLRSLLAAAKTNRLSPSQFSLISLQIRNNPHLVLR 335 AVSIL HHRSK RWS LRSL + + +PSQFS I+L +RNNPHL LR Sbjct: 45 AVSILTHHRSKSRWSTLRSL----QPSGFTPSQFSEITLCLRNNPHLSLR 90 >ref|XP_003537906.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980-like [Glycine max] Length = 487 Score = 55.5 bits (132), Expect = 5e-06 Identities = 29/50 (58%), Positives = 36/50 (72%) Frame = +3 Query: 186 AVSILKHHRSKPRWSHLRSLLAAAKTNRLSPSQFSLISLQIRNNPHLVLR 335 AVSIL HHRSK RWS+LRS A N ++P++FS I+L I+N P L LR Sbjct: 38 AVSILTHHRSKSRWSNLRS----ACPNGITPAEFSEITLHIKNKPQLALR 83 >emb|CBI32533.3| unnamed protein product [Vitis vinifera] Length = 299 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/49 (59%), Positives = 34/49 (69%) Frame = +3 Query: 186 AVSILKHHRSKPRWSHLRSLLAAAKTNRLSPSQFSLISLQIRNNPHLVL 332 AVSIL+H RSK RWSHL+SL T P++ S I LQI+NNPHL L Sbjct: 40 AVSILRHQRSKSRWSHLQSLFPKGFT----PTEASQIVLQIKNNPHLAL 84 >ref|XP_002281132.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980-like [Vitis vinifera] Length = 492 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/49 (59%), Positives = 34/49 (69%) Frame = +3 Query: 186 AVSILKHHRSKPRWSHLRSLLAAAKTNRLSPSQFSLISLQIRNNPHLVL 332 AVSIL+H RSK RWSHL+SL T P++ S I LQI+NNPHL L Sbjct: 40 AVSILRHQRSKSRWSHLQSLFPKGFT----PTEASQIVLQIKNNPHLAL 84