BLASTX nr result
ID: Scutellaria23_contig00021438
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00021438 (293 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268980.1| PREDICTED: pentatricopeptide repeat-containi... 57 1e-06 emb|CBI28186.3| unnamed protein product [Vitis vinifera] 57 2e-06 ref|XP_002281953.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_003559825.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_002888986.1| hypothetical protein ARALYDRAFT_476599 [Arab... 57 2e-06 >ref|XP_002268980.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic [Vitis vinifera] gi|297733984|emb|CBI15231.3| unnamed protein product [Vitis vinifera] Length = 893 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/48 (62%), Positives = 35/48 (72%) Frame = -2 Query: 292 ELHPSDAGAYVSVSNIYAEAGDWERVLKIRGSMEEMGVRKKEAGWSYV 149 EL P +AGAYV++SNI A+ G WE V+KIR ME GV KKE GWS V Sbjct: 847 ELEPCEAGAYVTLSNICADMGWWEDVMKIRSLMEGTGV-KKEPGWSSV 893 >emb|CBI28186.3| unnamed protein product [Vitis vinifera] Length = 760 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = -2 Query: 292 ELHPSDAGAYVSVSNIYAEAGDWERVLKIRGSMEEMGVRKKEAGWSYV 149 E+ P +G+YV +SN+YAE G+WE+V KIR M E GVR KE G+S+V Sbjct: 650 EMEPMGSGSYVLMSNLYAEKGEWEKVAKIRKGMRERGVR-KEIGFSWV 696 >ref|XP_002281953.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32430, mitochondrial [Vitis vinifera] Length = 773 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = -2 Query: 292 ELHPSDAGAYVSVSNIYAEAGDWERVLKIRGSMEEMGVRKKEAGWSYV 149 E+ P +G+YV +SN+YAE G+WE+V KIR M E GVR KE G+S+V Sbjct: 673 EMEPMGSGSYVLMSNLYAEKGEWEKVAKIRKGMRERGVR-KEIGFSWV 719 >ref|XP_003559825.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32430, mitochondrial-like [Brachypodium distachyon] Length = 739 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/48 (58%), Positives = 35/48 (72%) Frame = -2 Query: 292 ELHPSDAGAYVSVSNIYAEAGDWERVLKIRGSMEEMGVRKKEAGWSYV 149 E P+++GAYV +SNIYAE GDW V K+R M E GVR KE G+S+V Sbjct: 641 ETEPTESGAYVLLSNIYAEKGDWGGVAKVRREMREKGVR-KEIGFSWV 687 >ref|XP_002888986.1| hypothetical protein ARALYDRAFT_476599 [Arabidopsis lyrata subsp. lyrata] gi|297334827|gb|EFH65245.1| hypothetical protein ARALYDRAFT_476599 [Arabidopsis lyrata subsp. lyrata] Length = 717 Score = 56.6 bits (135), Expect = 2e-06 Identities = 29/48 (60%), Positives = 35/48 (72%) Frame = -2 Query: 292 ELHPSDAGAYVSVSNIYAEAGDWERVLKIRGSMEEMGVRKKEAGWSYV 149 EL PSDAGAYVS+SNI AE G+W+ V + R M+ GV +KE GWS V Sbjct: 671 ELEPSDAGAYVSLSNILAEVGEWDEVEETRKLMKGTGV-QKEPGWSSV 717