BLASTX nr result
ID: Scutellaria23_contig00021298
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00021298 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD55602.1|AC008016_12 Similar to gb|X80301 auxin-independent... 55 8e-06 >gb|AAD55602.1|AC008016_12 Similar to gb|X80301 auxin-independent growth promoter (axi 1) from Nicotiana tabacum. EST gb|AA605466 comes from this gene [Arabidopsis thaliana] Length = 399 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 226 C*NAAALLAKSNGYLRVDCYGGLNQMRRDV 137 C N AAL AK+NGY+RVDCYGGLNQMRRD+ Sbjct: 24 CSNPAALPAKTNGYIRVDCYGGLNQMRRDL 53