BLASTX nr result
ID: Scutellaria23_contig00021193
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00021193 (343 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_180334.1| cysteine/histidine-rich C1 domain-containing pr... 101 6e-20 ref|XP_002530545.1| protein binding protein, putative [Ricinus c... 92 3e-17 ref|XP_002317723.1| predicted protein [Populus trichocarpa] gi|2... 92 3e-17 ref|XP_002268131.1| PREDICTED: uncharacterized protein LOC100261... 91 1e-16 emb|CAN66246.1| hypothetical protein VITISV_033016 [Vitis vinifera] 91 1e-16 >ref|NP_180334.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|3860266|gb|AAC73034.1| hypothetical protein [Arabidopsis thaliana] gi|330252929|gb|AEC08023.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 718 Score = 101 bits (252), Expect = 6e-20 Identities = 44/92 (47%), Positives = 59/92 (64%) Frame = -2 Query: 276 QSCATLPQLITHPSHGGCTLSLLAVSSYPGGVFNCNACSSRGDAWNYHCPRCEYDLHVTC 97 +SC+ + Q+ITHPSH TLSLL Y GG FNC+ C G ++Y C C++D+H C Sbjct: 56 ESCSKMKQVITHPSHPSHTLSLLVAPVYDGGYFNCDGCGIHGTGFSYQCSVCDFDIHALC 115 Query: 96 ALKPLRIKHYSHTSCDLELTFKNPYANSGGFS 1 A KPL I H SH +L+L F++PY + GFS Sbjct: 116 AYKPLSIIHKSHPQHNLKLAFQSPYGANKGFS 147 >ref|XP_002530545.1| protein binding protein, putative [Ricinus communis] gi|223529907|gb|EEF31836.1| protein binding protein, putative [Ricinus communis] Length = 324 Score = 92.4 bits (228), Expect = 3e-17 Identities = 43/88 (48%), Positives = 52/88 (59%) Frame = -2 Query: 273 SCATLPQLITHPSHGGCTLSLLAVSSYPGGVFNCNACSSRGDAWNYHCPRCEYDLHVTCA 94 SC+ LP LITHPSH TL LL YP GVF+C+AC G + YHC C +D+H TCA Sbjct: 57 SCSQLPSLITHPSHPNHTLDLLPSPIYPNGVFSCDACGHGGLGFGYHCNHCSFDIHTTCA 116 Query: 93 LKPLRIKHYSHTSCDLELTFKNPYANSG 10 PL + + H L+LTF PY G Sbjct: 117 QNPLSLTNQFHPHL-LQLTFDPPYHTKG 143 >ref|XP_002317723.1| predicted protein [Populus trichocarpa] gi|222858396|gb|EEE95943.1| predicted protein [Populus trichocarpa] Length = 326 Score = 92.4 bits (228), Expect = 3e-17 Identities = 40/88 (45%), Positives = 52/88 (59%) Frame = -2 Query: 273 SCATLPQLITHPSHGGCTLSLLAVSSYPGGVFNCNACSSRGDAWNYHCPRCEYDLHVTCA 94 SC +P LITHP H L+L + YPGG FNC+ C +G+ +NYHC C++D+H+ CA Sbjct: 56 SCTQMPTLITHPCHPIHPLTLFSTPVYPGGSFNCDGCGLQGNGFNYHCTTCDFDVHMMCA 115 Query: 93 LKPLRIKHYSHTSCDLELTFKNPYANSG 10 PL + H SH L L F PY G Sbjct: 116 TNPLSLAHQSHPH-QLNLAFYPPYQTKG 142 >ref|XP_002268131.1| PREDICTED: uncharacterized protein LOC100261320 [Vitis vinifera] Length = 360 Score = 90.5 bits (223), Expect = 1e-16 Identities = 42/86 (48%), Positives = 54/86 (62%) Frame = -2 Query: 273 SCATLPQLITHPSHGGCTLSLLAVSSYPGGVFNCNACSSRGDAWNYHCPRCEYDLHVTCA 94 SC+ +PQ ITH H LSLL +YP G+FNC+AC +G+ ++YHC C DLH+ CA Sbjct: 61 SCSQMPQQITHSFHKAHALSLLPNPAYPEGLFNCDACGKQGNGFSYHCGVCNIDLHILCA 120 Query: 93 LKPLRIKHYSHTSCDLELTFKNPYAN 16 KPL + H SH L L+F PY N Sbjct: 121 SKPLFLNHQSHHH-RLALSFSPPYHN 145 >emb|CAN66246.1| hypothetical protein VITISV_033016 [Vitis vinifera] Length = 366 Score = 90.5 bits (223), Expect = 1e-16 Identities = 42/86 (48%), Positives = 54/86 (62%) Frame = -2 Query: 273 SCATLPQLITHPSHGGCTLSLLAVSSYPGGVFNCNACSSRGDAWNYHCPRCEYDLHVTCA 94 SC+ +PQ ITH H LSLL +YP G+FNC+AC +G+ ++YHC C DLH+ CA Sbjct: 67 SCSQMPQQITHSFHKAHALSLLPNPAYPEGLFNCDACGKQGNGFSYHCGVCNIDLHILCA 126 Query: 93 LKPLRIKHYSHTSCDLELTFKNPYAN 16 KPL + H SH L L+F PY N Sbjct: 127 SKPLFLNHQSHHH-RLALSFSPPYHN 151