BLASTX nr result
ID: Scutellaria23_contig00021067
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00021067 (693 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002885782.1| hypothetical protein ARALYDRAFT_899310 [Arab... 58 2e-06 >ref|XP_002885782.1| hypothetical protein ARALYDRAFT_899310 [Arabidopsis lyrata subsp. lyrata] gi|297331622|gb|EFH62041.1| hypothetical protein ARALYDRAFT_899310 [Arabidopsis lyrata subsp. lyrata] Length = 279 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/77 (38%), Positives = 47/77 (61%), Gaps = 2/77 (2%) Frame = +2 Query: 464 YKTWTRPLITSFYVSSLSIVYFSLVFILTVPLLVWPNFTIFWVAMFVGIPAL--VFHLYL 637 +K+W PL+T FY++ + Y L I+ PLLV+ + F VA V + L V+ YL Sbjct: 99 FKSWKGPLVTKFYIALFILGYGFLYAIIFCPLLVFSSKLFFLVAKSVPLLILLEVYESYL 158 Query: 638 IVPWTLSIVVSVVEESY 688 + W LS+V+S++EE+Y Sbjct: 159 AIVWNLSMVISILEETY 175