BLASTX nr result
ID: Scutellaria23_contig00021059
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00021059 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|O22642.3|CYC_FRIAG RecName: Full=Cytochrome c gi|2641197|gb|A... 64 1e-08 sp|P62772.1|CYC_BRANA RecName: Full=Cytochrome c gi|51317000|sp|... 63 2e-08 ref|XP_003568426.1| PREDICTED: cytochrome c-like [Brachypodium d... 63 2e-08 sp|P00051.1|CYC_CUCMA RecName: Full=Cytochrome c 63 2e-08 dbj|BAJ95186.1| predicted protein [Hordeum vulgare subsp. vulgare] 63 3e-08 >sp|O22642.3|CYC_FRIAG RecName: Full=Cytochrome c gi|2641197|gb|AAB86850.1| cytochrome C [Fritillaria agrestis] Length = 113 Score = 64.3 bits (155), Expect = 1e-08 Identities = 32/34 (94%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -1 Query: 309 NPKKYIPA-KMVFPGLKKPQDRADLIAYLKEATS 211 NPKKYIP KMVFPGLKKPQDRADLIAYLKEATS Sbjct: 79 NPKKYIPGTKMVFPGLKKPQDRADLIAYLKEATS 112 >sp|P62772.1|CYC_BRANA RecName: Full=Cytochrome c gi|51317000|sp|P62773.1|CYC_BRAOL RecName: Full=Cytochrome c gi|229347|prf||711058A cytochrome c Length = 111 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -1 Query: 309 NPKKYIPA-KMVFPGLKKPQDRADLIAYLKEATS 211 NPKKYIP KMVFPGLKKPQDRADLIAYLKEAT+ Sbjct: 78 NPKKYIPGTKMVFPGLKKPQDRADLIAYLKEATA 111 >ref|XP_003568426.1| PREDICTED: cytochrome c-like [Brachypodium distachyon] Length = 113 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -1 Query: 309 NPKKYIPA-KMVFPGLKKPQDRADLIAYLKEATS 211 NPKKYIP KMVFPGLKKPQDRADLI+YLKEATS Sbjct: 79 NPKKYIPGTKMVFPGLKKPQDRADLISYLKEATS 112 >sp|P00051.1|CYC_CUCMA RecName: Full=Cytochrome c Length = 111 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -1 Query: 309 NPKKYIPA-KMVFPGLKKPQDRADLIAYLKEATS 211 NPKKYIP KMVFPGLKKPQDRADLIAYLKEAT+ Sbjct: 78 NPKKYIPGTKMVFPGLKKPQDRADLIAYLKEATA 111 >dbj|BAJ95186.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 113 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -1 Query: 309 NPKKYIPA-KMVFPGLKKPQDRADLIAYLKEATS 211 NPKKYIP KMVFPGLKKPQDRADLIAYLK+ATS Sbjct: 79 NPKKYIPGTKMVFPGLKKPQDRADLIAYLKKATS 112