BLASTX nr result
ID: Scutellaria23_contig00020998
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00020998 (300 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004147838.1| PREDICTED: uncharacterized protein LOC101217... 55 5e-06 >ref|XP_004147838.1| PREDICTED: uncharacterized protein LOC101217301 [Cucumis sativus] gi|449476874|ref|XP_004154861.1| PREDICTED: uncharacterized LOC101217301 [Cucumis sativus] Length = 539 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = -2 Query: 122 AASTGALPSLRQAFSLLSDPQTQSIPVHSLQKCFDLTFES 3 AASTGALP L+ AFS L DPQT +IP SLQKCF L +E+ Sbjct: 22 AASTGALPQLQSAFSKLVDPQTNAIPFESLQKCFFLGYEN 61