BLASTX nr result
ID: Scutellaria23_contig00020744
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00020744 (381 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300088.1| cytochrome P450 [Populus trichocarpa] gi|222... 123 2e-26 ref|XP_002327096.1| cytochrome P450 [Populus trichocarpa] gi|222... 116 2e-24 dbj|BAM36726.1| nicotine N-demethylase [Nicotiana alata] 116 2e-24 ref|XP_002531093.1| cytochrome P450, putative [Ricinus communis]... 115 3e-24 gb|ABR57311.1| cytochrome P450 monooxygenase [Nicotiana sylvestris] 115 3e-24 >ref|XP_002300088.1| cytochrome P450 [Populus trichocarpa] gi|222847346|gb|EEE84893.1| cytochrome P450 [Populus trichocarpa] Length = 461 Score = 123 bits (308), Expect = 2e-26 Identities = 56/89 (62%), Positives = 68/89 (76%) Frame = +2 Query: 2 FLNSHGEVDFTGHHHEFIPFGSGRRSCPGITFAMQVTHLTLARLLQGFEFKTTSNMPVDL 181 FL H VD GHH E IPFGSGRRSCPGITFA+QV HLT ARLLQGF+ KT + VD+ Sbjct: 372 FLTDHANVDVLGHHFELIPFGSGRRSCPGITFALQVLHLTFARLLQGFDMKTPTGESVDM 431 Query: 182 SEGLGITMPKQTPLELLVSPRLVDVLYHD 268 +EG+ IT+PK TPLE+ ++PRL LY++ Sbjct: 432 TEGVAITLPKATPLEIQITPRLSPELYYE 460 >ref|XP_002327096.1| cytochrome P450 [Populus trichocarpa] gi|222835411|gb|EEE73846.1| cytochrome P450 [Populus trichocarpa] Length = 392 Score = 116 bits (291), Expect = 2e-24 Identities = 54/87 (62%), Positives = 66/87 (75%) Frame = +2 Query: 2 FLNSHGEVDFTGHHHEFIPFGSGRRSCPGITFAMQVTHLTLARLLQGFEFKTTSNMPVDL 181 FL SHG+VD G E IPFGSGRRSCPG++FA+QV HLTLARLL FE T + PVDL Sbjct: 304 FLTSHGDVDVRGQQFELIPFGSGRRSCPGVSFALQVLHLTLARLLHSFELATPMDQPVDL 363 Query: 182 SEGLGITMPKQTPLELLVSPRLVDVLY 262 +E G+T+PK TPLE++++PRL LY Sbjct: 364 TESSGLTIPKATPLEVILTPRLPPKLY 390 >dbj|BAM36726.1| nicotine N-demethylase [Nicotiana alata] Length = 515 Score = 116 bits (290), Expect = 2e-24 Identities = 48/82 (58%), Positives = 68/82 (82%) Frame = +2 Query: 17 GEVDFTGHHHEFIPFGSGRRSCPGITFAMQVTHLTLARLLQGFEFKTTSNMPVDLSEGLG 196 G++DF G H+E+IPFGSGRRSCPG+T+A+QV HLT+ARL+QGF ++T +N P+D+ EG G Sbjct: 434 GDIDFRGQHYEYIPFGSGRRSCPGMTYALQVEHLTMARLIQGFNYRTPTNEPLDMKEGAG 493 Query: 197 ITMPKQTPLELLVSPRLVDVLY 262 IT+ K P+E++++PRL LY Sbjct: 494 ITIRKVNPVEVIITPRLAHELY 515 >ref|XP_002531093.1| cytochrome P450, putative [Ricinus communis] gi|223529339|gb|EEF31307.1| cytochrome P450, putative [Ricinus communis] Length = 523 Score = 115 bits (289), Expect = 3e-24 Identities = 52/87 (59%), Positives = 66/87 (75%) Frame = +2 Query: 2 FLNSHGEVDFTGHHHEFIPFGSGRRSCPGITFAMQVTHLTLARLLQGFEFKTTSNMPVDL 181 FL +H +VDF G + EFIPF SGRRSCP ITF +QV HLTLAR+LQGF+ T +PVD+ Sbjct: 434 FLTTHSDVDFRGQNFEFIPFSSGRRSCPAITFGLQVVHLTLARVLQGFDLTTIGGLPVDM 493 Query: 182 SEGLGITMPKQTPLELLVSPRLVDVLY 262 +EGLGI +PK P+E+++ PRL LY Sbjct: 494 TEGLGIALPKVNPVEVIIKPRLGLELY 520 >gb|ABR57311.1| cytochrome P450 monooxygenase [Nicotiana sylvestris] Length = 517 Score = 115 bits (289), Expect = 3e-24 Identities = 49/82 (59%), Positives = 67/82 (81%) Frame = +2 Query: 17 GEVDFTGHHHEFIPFGSGRRSCPGITFAMQVTHLTLARLLQGFEFKTTSNMPVDLSEGLG 196 G++DF GHH+EFIPFGSGRRSCPG+T+A+QV HLT+A L+QGF +KT ++ +D+ EG G Sbjct: 436 GDIDFRGHHYEFIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYKTPNDEALDMKEGAG 495 Query: 197 ITMPKQTPLELLVSPRLVDVLY 262 IT+ K P+EL+++PRL LY Sbjct: 496 ITIRKVNPVELIITPRLAPELY 517