BLASTX nr result
ID: Scutellaria23_contig00020412
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00020412 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q76CU2.1|PDR1_TOBAC RecName: Full=Pleiotropic drug resistance... 70 3e-24 dbj|BAB92011.1| pleiotropic drug resistance like protein [Nicoti... 70 3e-24 ref|XP_002527332.1| ATP-binding cassette transporter, putative [... 70 1e-23 ref|XP_002527330.1| ATP-binding cassette transporter, putative [... 67 5e-23 ref|XP_002298123.1| pleiotropic drug resistance, ABC transporte... 67 5e-23 >sp|Q76CU2.1|PDR1_TOBAC RecName: Full=Pleiotropic drug resistance protein 1; AltName: Full=NtPDR1 gi|41052472|dbj|BAD07483.1| PDR-type ABC transporter 1 [Nicotiana tabacum] Length = 1434 Score = 70.5 bits (171), Expect(2) = 3e-24 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = -2 Query: 128 QTILNSLHILSNKKKAFTILKDVSGIIKPGRMTLLLGPPSSG 3 +T+LNSLHILS++K+ TILKD+SGIIKP RMTLLLGPPSSG Sbjct: 158 ETLLNSLHILSSRKRQLTILKDISGIIKPCRMTLLLGPPSSG 199 Score = 66.2 bits (160), Expect(2) = 3e-24 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = -3 Query: 343 RVGIETPTIEVRYEHLNVEAEAYSTSRALPTFLTFHINLVEVIIN 209 RVGI+ PTIEVRYEHLN++A+AY SR+LPTF+ F N VE ++N Sbjct: 118 RVGIDLPTIEVRYEHLNIDADAYVGSRSLPTFMNFMTNFVETLLN 162 >dbj|BAB92011.1| pleiotropic drug resistance like protein [Nicotiana tabacum] Length = 1434 Score = 70.5 bits (171), Expect(2) = 3e-24 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = -2 Query: 128 QTILNSLHILSNKKKAFTILKDVSGIIKPGRMTLLLGPPSSG 3 +T+LNSLHILS++K+ TILKD+SGIIKP RMTLLLGPPSSG Sbjct: 158 ETLLNSLHILSSRKRQLTILKDISGIIKPCRMTLLLGPPSSG 199 Score = 66.2 bits (160), Expect(2) = 3e-24 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = -3 Query: 343 RVGIETPTIEVRYEHLNVEAEAYSTSRALPTFLTFHINLVEVIIN 209 RVGI+ PTIEVRYEHLN++A+AY SR+LPTF+ F N VE ++N Sbjct: 118 RVGIDLPTIEVRYEHLNIDADAYVGSRSLPTFMNFMTNFVETLLN 162 >ref|XP_002527332.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223533332|gb|EEF35084.1| ATP-binding cassette transporter, putative [Ricinus communis] Length = 1443 Score = 69.7 bits (169), Expect(2) = 1e-23 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = -2 Query: 131 FQTILNSLHILSNKKKAFTILKDVSGIIKPGRMTLLLGPPSSG 3 F+ LNSLHIL ++KK TILKDVSG+IKP RMTLLLGPPSSG Sbjct: 151 FEGFLNSLHILPSRKKQLTILKDVSGVIKPSRMTLLLGPPSSG 193 Score = 64.7 bits (156), Expect(2) = 1e-23 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -3 Query: 343 RVGIETPTIEVRYEHLNVEAEAYSTSRALPTFLTFHINLVEVIIN 209 RVGIE PTIEVR+E+LN+EAEA+ SRALPTF+ F INL E +N Sbjct: 112 RVGIELPTIEVRFENLNIEAEAFVGSRALPTFVNFSINLFEGFLN 156 >ref|XP_002527330.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223533330|gb|EEF35082.1| ATP-binding cassette transporter, putative [Ricinus communis] Length = 1437 Score = 67.4 bits (163), Expect(2) = 5e-23 Identities = 33/54 (61%), Positives = 43/54 (79%) Frame = -3 Query: 343 RVGIETPTIEVRYEHLNVEAEAYSTSRALPTFLTFHINLVEVIINMHKAFLYLL 182 RVGIE PTIEVRYEHLN+EAEA S RALP+F+ F I+++E ++N FL++L Sbjct: 109 RVGIELPTIEVRYEHLNIEAEAVSGGRALPSFVNFSISIIEGLLN----FLHIL 158 Score = 65.1 bits (157), Expect(2) = 5e-23 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -2 Query: 122 ILNSLHILSNKKKAFTILKDVSGIIKPGRMTLLLGPPSSG 3 +LN LHIL ++ + FTILKDVSGIIKP RMTLLLGPPSSG Sbjct: 151 LLNFLHILPSRTRPFTILKDVSGIIKPSRMTLLLGPPSSG 190 >ref|XP_002298123.1| pleiotropic drug resistance, ABC transporter family protein [Populus trichocarpa] gi|222845381|gb|EEE82928.1| pleiotropic drug resistance, ABC transporter family protein [Populus trichocarpa] Length = 1424 Score = 67.0 bits (162), Expect(2) = 5e-23 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = -3 Query: 343 RVGIETPTIEVRYEHLNVEAEAYSTSRALPTFLTFHINLVEVIIN 209 RVGI PTIEVR+EHLNVEAEAY SRALPTF + +N++E ++N Sbjct: 114 RVGIHVPTIEVRFEHLNVEAEAYVGSRALPTFFNYSVNMLEGVLN 158 Score = 65.5 bits (158), Expect(2) = 5e-23 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -2 Query: 122 ILNSLHILSNKKKAFTILKDVSGIIKPGRMTLLLGPPSSG 3 +LN LHILS++KK ILKDVSGIIKP RMTLLLGPPSSG Sbjct: 156 VLNYLHILSSRKKHMWILKDVSGIIKPSRMTLLLGPPSSG 195