BLASTX nr result
ID: Scutellaria23_contig00020385
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00020385 (573 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272910.2| PREDICTED: rop guanine nucleotide exchange f... 63 3e-08 emb|CBI30469.3| unnamed protein product [Vitis vinifera] 63 3e-08 ref|XP_002337846.1| predicted protein [Populus trichocarpa] gi|2... 62 7e-08 ref|XP_002534083.1| Rop guanine nucleotide exchange factor, puta... 60 2e-07 ref|XP_004157057.1| PREDICTED: rop guanine nucleotide exchange f... 57 2e-06 >ref|XP_002272910.2| PREDICTED: rop guanine nucleotide exchange factor 1-like [Vitis vinifera] Length = 701 Score = 63.2 bits (152), Expect = 3e-08 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = +2 Query: 464 DKIHLEKQGSSLSEFEMMRERFSKLLLGEDMSGCGN 571 D++ LEKQGS++S+ EMM+ERFSKLLLGEDMSGCGN Sbjct: 189 DEMKLEKQGSTISDIEMMKERFSKLLLGEDMSGCGN 224 >emb|CBI30469.3| unnamed protein product [Vitis vinifera] Length = 1231 Score = 63.2 bits (152), Expect = 3e-08 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = +2 Query: 464 DKIHLEKQGSSLSEFEMMRERFSKLLLGEDMSGCGN 571 D++ LEKQGS++S+ EMM+ERFSKLLLGEDMSGCGN Sbjct: 719 DEMKLEKQGSTISDIEMMKERFSKLLLGEDMSGCGN 754 >ref|XP_002337846.1| predicted protein [Populus trichocarpa] gi|222869901|gb|EEF07032.1| predicted protein [Populus trichocarpa] Length = 136 Score = 62.0 bits (149), Expect = 7e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +2 Query: 464 DKIHLEKQGSSLSEFEMMRERFSKLLLGEDMSGCGN 571 D LEKQGSS+SE EMM+ERFSKLLLGEDMSGCGN Sbjct: 100 DDRKLEKQGSSVSETEMMKERFSKLLLGEDMSGCGN 135 >ref|XP_002534083.1| Rop guanine nucleotide exchange factor, putative [Ricinus communis] gi|223525876|gb|EEF28299.1| Rop guanine nucleotide exchange factor, putative [Ricinus communis] Length = 673 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 476 LEKQGSSLSEFEMMRERFSKLLLGEDMSGCGN 571 LEKQ SS+SE EMM+ERFSKLLLGEDMSGCGN Sbjct: 204 LEKQASSISEIEMMKERFSKLLLGEDMSGCGN 235 >ref|XP_004157057.1| PREDICTED: rop guanine nucleotide exchange factor 1-like [Cucumis sativus] Length = 598 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +2 Query: 464 DKIHLEKQGSSLSEFEMMRERFSKLLLGEDMSGCGN 571 D LEK+ SS SE EMM+ERFSKLLLGEDMSGCGN Sbjct: 91 DNRKLEKKVSSSSEIEMMKERFSKLLLGEDMSGCGN 126