BLASTX nr result
ID: Scutellaria23_contig00020314
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00020314 (588 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|JAA67744.1| Putative auxin response factor [Ixodes ricinus] 59 8e-07 >gb|JAA67744.1| Putative auxin response factor [Ixodes ricinus] Length = 155 Score = 58.5 bits (140), Expect = 8e-07 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = -2 Query: 149 ANYSSISQQQRNS-YSTEGIGAYDSMYEELWRACAGPLVDVPKARESVY 6 AN S QQQ+NS +S +G G D++YEE W+ACAGPLVDV K E VY Sbjct: 3 ANRVSFGQQQQNSNFSGQGNGVKDALYEEFWKACAGPLVDVLKVGERVY 51