BLASTX nr result
ID: Scutellaria23_contig00020165
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00020165 (529 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002326546.1| predicted protein [Populus trichocarpa] gi|2... 85 6e-15 ref|XP_002278005.2| PREDICTED: probable transcription factor KAN... 84 1e-14 ref|XP_002303435.1| predicted protein [Populus trichocarpa] gi|2... 84 1e-14 ref|XP_002518978.1| transcription factor, putative [Ricinus comm... 84 2e-14 ref|XP_003534288.1| PREDICTED: uncharacterized protein LOC100798... 80 1e-13 >ref|XP_002326546.1| predicted protein [Populus trichocarpa] gi|222833868|gb|EEE72345.1| predicted protein [Populus trichocarpa] Length = 378 Score = 85.1 bits (209), Expect = 6e-15 Identities = 37/42 (88%), Positives = 42/42 (100%) Frame = -1 Query: 259 MELFPAQPDLSLQISPPNSKPSSSWRRSEDEMDLGFWRRALD 134 MELFPAQPDLSLQISPPNSKP+S+WRR+E+EMDLGFW+RALD Sbjct: 1 MELFPAQPDLSLQISPPNSKPTSTWRRTEEEMDLGFWKRALD 42 >ref|XP_002278005.2| PREDICTED: probable transcription factor KAN2-like [Vitis vinifera] Length = 368 Score = 84.3 bits (207), Expect = 1e-14 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -1 Query: 259 MELFPAQPDLSLQISPPNSKPSSSWRRSEDEMDLGFWRRALD 134 MELFPAQPDLSLQISPPNSKPSS WRR+E+E+DLGFW+RALD Sbjct: 1 MELFPAQPDLSLQISPPNSKPSSGWRRAEEEVDLGFWKRALD 42 >ref|XP_002303435.1| predicted protein [Populus trichocarpa] gi|222840867|gb|EEE78414.1| predicted protein [Populus trichocarpa] Length = 332 Score = 84.0 bits (206), Expect = 1e-14 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -1 Query: 259 MELFPAQPDLSLQISPPNSKPSSSWRRSEDEMDLGFWRRALD 134 MELFPAQPDLSLQISPPNSKP+S+WRR+E+EMDLGFW RALD Sbjct: 1 MELFPAQPDLSLQISPPNSKPTSTWRRTEEEMDLGFWTRALD 42 >ref|XP_002518978.1| transcription factor, putative [Ricinus communis] gi|223541965|gb|EEF43511.1| transcription factor, putative [Ricinus communis] Length = 340 Score = 83.6 bits (205), Expect = 2e-14 Identities = 36/42 (85%), Positives = 42/42 (100%) Frame = -1 Query: 259 MELFPAQPDLSLQISPPNSKPSSSWRRSEDEMDLGFWRRALD 134 MELFPAQPDLSLQISPPNSKP+S+WRR+E+E+DLGFW+RALD Sbjct: 1 MELFPAQPDLSLQISPPNSKPTSTWRRTEEEIDLGFWKRALD 42 >ref|XP_003534288.1| PREDICTED: uncharacterized protein LOC100798081 [Glycine max] Length = 390 Score = 80.5 bits (197), Expect = 1e-13 Identities = 37/43 (86%), Positives = 42/43 (97%), Gaps = 1/43 (2%) Frame = -1 Query: 259 MELFPAQPDLSLQISPPNSKPSSSWRRS-EDEMDLGFWRRALD 134 MELFPAQPDLSLQISPPN+KP+SSWRRS E++MDLGFW+RALD Sbjct: 1 MELFPAQPDLSLQISPPNAKPTSSWRRSTEEDMDLGFWKRALD 43