BLASTX nr result
ID: Scutellaria23_contig00019935
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00019935 (645 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004165513.1| PREDICTED: transcription repressor MYB6-like... 100 4e-19 ref|XP_004150815.1| PREDICTED: transcription repressor MYB6-like... 100 4e-19 gb|AAB58314.1| Cpm7 [Craterostigma plantagineum] 100 4e-19 gb|AAM43912.1|AF510112_1 MYB transcription factor [Craterostigma... 100 4e-19 gb|AAB58313.1| Cpm5 [Craterostigma plantagineum] 100 4e-19 >ref|XP_004165513.1| PREDICTED: transcription repressor MYB6-like [Cucumis sativus] Length = 263 Score = 99.8 bits (247), Expect = 4e-19 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -3 Query: 643 DNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ 509 DNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ Sbjct: 112 DNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ 156 >ref|XP_004150815.1| PREDICTED: transcription repressor MYB6-like [Cucumis sativus] Length = 263 Score = 99.8 bits (247), Expect = 4e-19 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -3 Query: 643 DNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ 509 DNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ Sbjct: 112 DNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ 156 >gb|AAB58314.1| Cpm7 [Craterostigma plantagineum] Length = 335 Score = 99.8 bits (247), Expect = 4e-19 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -3 Query: 643 DNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ 509 DNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ Sbjct: 115 DNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ 159 >gb|AAM43912.1|AF510112_1 MYB transcription factor [Craterostigma plantagineum] gi|1002796|gb|AAC13876.1| myb-related transcription factor Cpm10 [Craterostigma plantagineum] Length = 333 Score = 99.8 bits (247), Expect = 4e-19 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -3 Query: 643 DNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ 509 DNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ Sbjct: 116 DNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ 160 >gb|AAB58313.1| Cpm5 [Craterostigma plantagineum] Length = 333 Score = 99.8 bits (247), Expect = 4e-19 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -3 Query: 643 DNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ 509 DNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ Sbjct: 116 DNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ 160