BLASTX nr result
ID: Scutellaria23_contig00019929
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00019929 (573 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526954.1| protein with unknown function [Ricinus commu... 64 2e-08 ref|XP_002269112.1| PREDICTED: mitochondrial inner membrane prot... 62 5e-08 ref|XP_004142774.1| PREDICTED: mitochondrial inner membrane prot... 61 1e-07 ref|XP_002882292.1| ku70-binding family protein [Arabidopsis lyr... 60 3e-07 ref|NP_566205.1| ku70-binding-like protein [Arabidopsis thaliana... 60 3e-07 >ref|XP_002526954.1| protein with unknown function [Ricinus communis] gi|223533706|gb|EEF35441.1| protein with unknown function [Ricinus communis] Length = 187 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/73 (38%), Positives = 47/73 (64%) Frame = +1 Query: 145 QSSNGLSYGGMTMAECREMIQKALQQPKVKFVMEAMEKSGCPLNNPTNFIRPIKCVKPAT 324 + +N GG T+ EC++MI+K+L+ P VKF+ E +EK+GC + + NFI+ + C K + Sbjct: 4 EPTNTPGSGGRTIEECQDMIRKSLRTPMVKFLREHLEKAGCGIGD--NFIKAVNCEKKMS 61 Query: 325 ASYIPGRGVITSS 363 Y+ G G++ S Sbjct: 62 GGYVSGDGIVVCS 74 >ref|XP_002269112.1| PREDICTED: mitochondrial inner membrane protease ATP23 [Vitis vinifera] gi|296081332|emb|CBI17714.3| unnamed protein product [Vitis vinifera] Length = 195 Score = 62.4 bits (150), Expect = 5e-08 Identities = 31/71 (43%), Positives = 46/71 (64%) Frame = +1 Query: 151 SNGLSYGGMTMAECREMIQKALQQPKVKFVMEAMEKSGCPLNNPTNFIRPIKCVKPATAS 330 S+G++ GGMT+ EC +MIQK+L+ P VKF+ E +EKSGC + + FI+ I C + Sbjct: 15 SSGVN-GGMTVKECEQMIQKSLRTPMVKFLRENLEKSGCAIGD--KFIKAIYCNTKVSGG 71 Query: 331 YIPGRGVITSS 363 Y G G++ S Sbjct: 72 YARGEGIVVCS 82 >ref|XP_004142774.1| PREDICTED: mitochondrial inner membrane protease ATP23-like [Cucumis sativus] gi|449483813|ref|XP_004156699.1| PREDICTED: mitochondrial inner membrane protease ATP23-like [Cucumis sativus] Length = 195 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/65 (41%), Positives = 42/65 (64%) Frame = +1 Query: 169 GGMTMAECREMIQKALQQPKVKFVMEAMEKSGCPLNNPTNFIRPIKCVKPATASYIPGRG 348 GG T EC +MI+++L+ P VKF+ME +EKSGC + + FI+ + C K + Y+ G G Sbjct: 20 GGRTKEECEDMIRRSLRTPMVKFLMEHLEKSGCGIGD--RFIKAVHCEKQISGGYVRGEG 77 Query: 349 VITSS 363 ++ S Sbjct: 78 IMVCS 82 >ref|XP_002882292.1| ku70-binding family protein [Arabidopsis lyrata subsp. lyrata] gi|297328132|gb|EFH58551.1| ku70-binding family protein [Arabidopsis lyrata subsp. lyrata] Length = 195 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/64 (40%), Positives = 41/64 (64%) Frame = +1 Query: 172 GMTMAECREMIQKALQQPKVKFVMEAMEKSGCPLNNPTNFIRPIKCVKPATASYIPGRGV 351 G ++ EC++MI+++ + P VKF+ME MEKSGC + + NF++ + C P Y GRG+ Sbjct: 20 GKSIDECQDMIRRSFRNPIVKFLMEQMEKSGCRVGD--NFVKAVVCTGPVAGGYTKGRGI 77 Query: 352 ITSS 363 S Sbjct: 78 TVCS 81 >ref|NP_566205.1| ku70-binding-like protein [Arabidopsis thaliana] gi|6017109|gb|AAF01592.1|AC009895_13 hypothetical protein [Arabidopsis thaliana] gi|13877935|gb|AAK44045.1|AF370230_1 unknown protein [Arabidopsis thaliana] gi|16323466|gb|AAL15227.1| unknown protein [Arabidopsis thaliana] gi|332640421|gb|AEE73942.1| ku70-binding-like protein [Arabidopsis thaliana] Length = 194 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/64 (40%), Positives = 41/64 (64%) Frame = +1 Query: 172 GMTMAECREMIQKALQQPKVKFVMEAMEKSGCPLNNPTNFIRPIKCVKPATASYIPGRGV 351 G ++ EC++MI+++ + P VKF+ME MEKSGC + + NF++ + C P Y GRG+ Sbjct: 20 GKSIDECQDMIRRSFRNPIVKFLMEQMEKSGCRVGD--NFVKAVVCTGPVAGGYTKGRGI 77 Query: 352 ITSS 363 S Sbjct: 78 TVCS 81