BLASTX nr result
ID: Scutellaria23_contig00019901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00019901 (370 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003526702.1| PREDICTED: mRNA cap guanine-N7 methyltransfe... 59 5e-07 ref|XP_003602217.1| mRNA cap guanine-N7 methyltransferase [Medic... 55 6e-06 >ref|XP_003526702.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like [Glycine max] Length = 346 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/45 (66%), Positives = 34/45 (75%), Gaps = 2/45 (4%) Frame = +1 Query: 1 QVVSWRDDE--KSVQPESSGGLGKITEQKGILGPGPAELRFPEAL 129 +V WRDDE E + GLGKI+EQKGILGPGPA+LRFPEAL Sbjct: 302 EVTIWRDDEVINGHVVEPAIGLGKISEQKGILGPGPADLRFPEAL 346 >ref|XP_003602217.1| mRNA cap guanine-N7 methyltransferase [Medicago truncatula] gi|355491265|gb|AES72468.1| mRNA cap guanine-N7 methyltransferase [Medicago truncatula] Length = 359 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/41 (70%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = +1 Query: 10 SWRDDEKSVQP-ESSGGLGKITEQKGILGPGPAELRFPEAL 129 SW D+E + +SS GLG I+EQKGILGPGPAELRFPEAL Sbjct: 319 SWWDEEINGHVVDSSIGLGMISEQKGILGPGPAELRFPEAL 359