BLASTX nr result
ID: Scutellaria23_contig00019860
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00019860 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEZ99877.1| hypothetical protein TcasGA2_TC002660 [Tribolium ... 55 8e-06 >gb|EEZ99877.1| hypothetical protein TcasGA2_TC002660 [Tribolium castaneum] Length = 319 Score = 54.7 bits (130), Expect = 8e-06 Identities = 30/76 (39%), Positives = 45/76 (59%) Frame = +1 Query: 76 SSFSNCKLENLSSLKLSFDKTNNDTTRRWNIPQDTFEGLYNIKELVINNAGQHHLPQKWF 255 S+F+NC NL SL ++F++ R + +DTF LYN++ELV+ N HL ++WF Sbjct: 113 STFANCG-NNLESLTVAFNEIY-----RPRLSEDTFYNLYNLRELVLRNQNIDHLTKRWF 166 Query: 256 EGLKSLTKLDLWECKI 303 +K L L L C+I Sbjct: 167 NNMKWLQVLVLENCRI 182