BLASTX nr result
ID: Scutellaria23_contig00019811
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00019811 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACJ49169.1| protection of telomeres 1 protein [Solanum tubero... 82 4e-14 gb|ACJ49170.1| protection of telomeres 1 protein [Nicotiana taba... 81 8e-14 ref|XP_002318516.1| predicted protein [Populus trichocarpa] gi|2... 80 1e-13 gb|ACJ49159.1| protection of telomeres 1 protein [Populus tricho... 80 1e-13 emb|CBI15581.3| unnamed protein product [Vitis vinifera] 80 2e-13 >gb|ACJ49169.1| protection of telomeres 1 protein [Solanum tuberosum] Length = 466 Score = 82.4 bits (202), Expect = 4e-14 Identities = 38/62 (61%), Positives = 49/62 (79%), Gaps = 1/62 (1%) Frame = -2 Query: 184 EDYKFMQIEDAMTCFNLRVNLIGVIVETSLPKSTKGTDFFCSVKIIDKSRPS-GMCINFF 8 +DYKF+QI DA +VNLIGV++ET LPK +KGTD FCS++IID+S PS G+ +NFF Sbjct: 8 DDYKFLQIVDARAALGQKVNLIGVVIETGLPKQSKGTDCFCSIRIIDESYPSPGIAVNFF 67 Query: 7 AE 2 AE Sbjct: 68 AE 69 >gb|ACJ49170.1| protection of telomeres 1 protein [Nicotiana tabacum] Length = 466 Score = 81.3 bits (199), Expect = 8e-14 Identities = 38/62 (61%), Positives = 49/62 (79%), Gaps = 1/62 (1%) Frame = -2 Query: 184 EDYKFMQIEDAMTCFNLRVNLIGVIVETSLPKSTKGTDFFCSVKIIDKSRPS-GMCINFF 8 +DYKF+QI DA N +V LIGV++ET LPK +KGTD FC++KIID+S PS G+ +NFF Sbjct: 8 DDYKFLQIVDARAALNQKVYLIGVVIETGLPKQSKGTDCFCTIKIIDESYPSPGISVNFF 67 Query: 7 AE 2 AE Sbjct: 68 AE 69 >ref|XP_002318516.1| predicted protein [Populus trichocarpa] gi|222859189|gb|EEE96736.1| predicted protein [Populus trichocarpa] Length = 412 Score = 80.5 bits (197), Expect = 1e-13 Identities = 35/60 (58%), Positives = 50/60 (83%), Gaps = 1/60 (1%) Frame = -2 Query: 184 EDYKFMQIEDAMTCFNLRVNLIGVIVETSLPKSTKGTDFFCSVKIIDKSRPS-GMCINFF 8 +DYKF++I+DA++ N +VNLIGV++E PK+T+GTDFFCSVKI+D+S P G+ +NFF Sbjct: 5 DDYKFLKIKDAISAINQKVNLIGVVIELGFPKTTRGTDFFCSVKIVDESYPKPGIPVNFF 64 >gb|ACJ49159.1| protection of telomeres 1 protein [Populus trichocarpa] Length = 462 Score = 80.5 bits (197), Expect = 1e-13 Identities = 35/60 (58%), Positives = 50/60 (83%), Gaps = 1/60 (1%) Frame = -2 Query: 184 EDYKFMQIEDAMTCFNLRVNLIGVIVETSLPKSTKGTDFFCSVKIIDKSRPS-GMCINFF 8 +DYKF++I+DA++ N +VNLIGV++E PK+T+GTDFFCSVKI+D+S P G+ +NFF Sbjct: 5 DDYKFLKIKDAISAINQKVNLIGVVIELGFPKTTRGTDFFCSVKIVDESYPKPGIPVNFF 64 >emb|CBI15581.3| unnamed protein product [Vitis vinifera] Length = 491 Score = 79.7 bits (195), Expect = 2e-13 Identities = 37/62 (59%), Positives = 49/62 (79%), Gaps = 1/62 (1%) Frame = -2 Query: 184 EDYKFMQIEDAMTCFNLRVNLIGVIVETSLPKSTKGTDFFCSVKIIDKS-RPSGMCINFF 8 +DY+FM IEDAM N +VN+IGV+VE +PK +KGTD FC+VKI+D+S R SG+ +N F Sbjct: 33 DDYRFMAIEDAMASLNQKVNIIGVVVEMGMPKRSKGTDCFCTVKIVDQSHRSSGISVNVF 92 Query: 7 AE 2 AE Sbjct: 93 AE 94