BLASTX nr result
ID: Scutellaria23_contig00019596
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00019596 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516788.1| pentatricopeptide repeat-containing protein,... 102 4e-20 emb|CBI26175.3| unnamed protein product [Vitis vinifera] 101 7e-20 ref|XP_002277532.1| PREDICTED: pentatricopeptide repeat-containi... 101 7e-20 ref|XP_003594127.1| Pentatricopeptide repeat-containing protein ... 97 2e-18 ref|XP_004165441.1| PREDICTED: pentatricopeptide repeat-containi... 96 2e-18 >ref|XP_002516788.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543876|gb|EEF45402.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 710 Score = 102 bits (253), Expect = 4e-20 Identities = 44/67 (65%), Positives = 58/67 (86%) Frame = +2 Query: 2 EAGERHFDSMRTIYGLEPNIKHYGCMVDILGRAGRLEEAEELVKRMPMKADVATWTTLLA 181 E+G+RHF SM++ + ++P+IKHYGCMVD+LGRAGRLEEAEE+++ MPMKADV W TLLA Sbjct: 582 ESGKRHFMSMKSEHSIDPDIKHYGCMVDLLGRAGRLEEAEEMIRSMPMKADVVIWGTLLA 641 Query: 182 ACKMYEN 202 AC+ + N Sbjct: 642 ACRTHGN 648 >emb|CBI26175.3| unnamed protein product [Vitis vinifera] Length = 619 Score = 101 bits (251), Expect = 7e-20 Identities = 41/67 (61%), Positives = 56/67 (83%) Frame = +2 Query: 2 EAGERHFDSMRTIYGLEPNIKHYGCMVDILGRAGRLEEAEELVKRMPMKADVATWTTLLA 181 + GE++F M+ +Y +EPNIKHYGCM+D+LGRAGRL+EA E++++MPMKADV W TLLA Sbjct: 493 DTGEKYFKGMKNLYNIEPNIKHYGCMIDLLGRAGRLKEAAEMIRKMPMKADVVIWGTLLA 552 Query: 182 ACKMYEN 202 AC+ + N Sbjct: 553 ACRTHGN 559 >ref|XP_002277532.1| PREDICTED: pentatricopeptide repeat-containing protein At5g19020, mitochondrial [Vitis vinifera] Length = 694 Score = 101 bits (251), Expect = 7e-20 Identities = 41/67 (61%), Positives = 56/67 (83%) Frame = +2 Query: 2 EAGERHFDSMRTIYGLEPNIKHYGCMVDILGRAGRLEEAEELVKRMPMKADVATWTTLLA 181 + GE++F M+ +Y +EPNIKHYGCM+D+LGRAGRL+EA E++++MPMKADV W TLLA Sbjct: 568 DTGEKYFKGMKNLYNIEPNIKHYGCMIDLLGRAGRLKEAAEMIRKMPMKADVVIWGTLLA 627 Query: 182 ACKMYEN 202 AC+ + N Sbjct: 628 ACRTHGN 634 >ref|XP_003594127.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|124365519|gb|ABN09753.1| Tetratricopeptide-like helical [Medicago truncatula] gi|355483175|gb|AES64378.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 727 Score = 96.7 bits (239), Expect = 2e-18 Identities = 41/67 (61%), Positives = 56/67 (83%) Frame = +2 Query: 2 EAGERHFDSMRTIYGLEPNIKHYGCMVDILGRAGRLEEAEELVKRMPMKADVATWTTLLA 181 E+G+R F +M++ Y +EP+IKHYGCM+DILGRAG LEEAEE+++ MPM+AD+ W TLLA Sbjct: 569 ESGKRIFKTMKSAYNVEPDIKHYGCMIDILGRAGLLEEAEEMIRSMPMEADIVIWGTLLA 628 Query: 182 ACKMYEN 202 AC+ + N Sbjct: 629 ACRTHGN 635 >ref|XP_004165441.1| PREDICTED: pentatricopeptide repeat-containing protein At5g19020, mitochondrial-like isoform 1 [Cucumis sativus] Length = 703 Score = 96.3 bits (238), Expect = 2e-18 Identities = 43/65 (66%), Positives = 54/65 (83%) Frame = +2 Query: 2 EAGERHFDSMRTIYGLEPNIKHYGCMVDILGRAGRLEEAEELVKRMPMKADVATWTTLLA 181 E GER+F SM+T +G+EPNIKHYGC+VD+LGR GRL EAEE+V+ MPMKADV W TLLA Sbjct: 577 EVGERYFWSMKTQHGVEPNIKHYGCLVDLLGRVGRLREAEEIVRTMPMKADVVIWGTLLA 636 Query: 182 ACKMY 196 + + + Sbjct: 637 SSRTH 641