BLASTX nr result
ID: Scutellaria23_contig00019184
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00019184 (224 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517400.1| Spotted leaf protein, putative [Ricinus comm... 55 8e-06 >ref|XP_002517400.1| Spotted leaf protein, putative [Ricinus communis] gi|223543411|gb|EEF44942.1| Spotted leaf protein, putative [Ricinus communis] Length = 558 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = -3 Query: 222 VIPNLALRSAILNWCRRHLVGLPEPLDRYSAEKIVSKLMPE 100 VIPNLAL+SAI+NWC +H + P+P+D +SAE+IV M E Sbjct: 129 VIPNLALKSAIINWCNKHSLEPPKPIDFFSAERIVRAKMEE 169