BLASTX nr result
ID: Scutellaria23_contig00018813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00018813 (358 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001234202.1| NRC1 [Solanum lycopersicum] gi|83630761|gb|A... 55 6e-06 >ref|NP_001234202.1| NRC1 [Solanum lycopersicum] gi|83630761|gb|ABC26878.1| NRC1 [Solanum lycopersicum] Length = 888 Score = 55.1 bits (131), Expect = 6e-06 Identities = 35/75 (46%), Positives = 46/75 (61%), Gaps = 2/75 (2%) Frame = +3 Query: 9 LRCLLIGTTNLVHWIASTNDFPQLKSLVLKGCDKLNKIPLCLAK--SLDIVDLESVAKSV 182 L+ L I NLV W AS + FP+LK L + CDKL KIP+ LA SL ++DL + KS Sbjct: 793 LQVLCIERANLVSWNASGDHFPRLKHLHI-SCDKLEKIPIGLADICSLQVMDLRNSTKSA 851 Query: 183 EDSAKEIEDIKPGLK 227 SA+EI+ K L+ Sbjct: 852 AKSAREIQAKKNKLQ 866