BLASTX nr result
ID: Scutellaria23_contig00018727
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00018727 (381 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535169.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] ... 57 2e-06 >ref|XP_002535169.1| conserved hypothetical protein [Ricinus communis] gi|223523841|gb|EEF27214.1| conserved hypothetical protein [Ricinus communis] Length = 84 Score = 58.5 bits (140), Expect = 5e-07 Identities = 38/83 (45%), Positives = 48/83 (57%), Gaps = 4/83 (4%) Frame = -3 Query: 238 FLRTSVAQHLLNPLFSGNRGSSLYSEARVFCLVVFVPGEEKLVL*SIFLYE----SSKQS 71 +LR V ++ +SG + ++ R+F EK S FLY S +QS Sbjct: 5 YLRAEVQSPVVAYPWSGRQAYTIGLTDRIF---------EK----SSFLYRAWTMSPEQS 51 Query: 70 QYIWRKTIPHIEVGMGSGVFTSH 2 QYIWRKTIPHIEVGMGSGVFTS+ Sbjct: 52 QYIWRKTIPHIEVGMGSGVFTSY 74 >ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] gi|355477385|gb|AES58588.1| Ribosomal protein S10 [Medicago truncatula] Length = 1152 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 2 VRRENTRSHSDLDMWNRLAPYVLRLF 79 VRRENTRSHSDLDMWNRLAPYVL+LF Sbjct: 574 VRRENTRSHSDLDMWNRLAPYVLKLF 599