BLASTX nr result
ID: Scutellaria23_contig00018404
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00018404 (433 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532371.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002532371.1| conserved hypothetical protein [Ricinus communis] gi|223527927|gb|EEF30014.1| conserved hypothetical protein [Ricinus communis] Length = 578 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/54 (50%), Positives = 32/54 (59%) Frame = -3 Query: 425 DVIDTXXXXXXXXXXXXLAPEWIYEKSTLSGDLLLCVNKISSPEVIRARLSEAK 264 D++D L PEWI +K SGD L C+NK+SSPE IRARL EAK Sbjct: 525 DIVDRREVEEQLDLLLELVPEWISKKLATSGDSLFCINKMSSPETIRARLEEAK 578