BLASTX nr result
ID: Scutellaria23_contig00018394
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00018394 (259 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEX07772.1| cytochrome P450 [Catharanthus roseus] gi|36592774... 142 2e-32 ref|XP_002522937.1| cytochrome P450, putative [Ricinus communis]... 132 2e-29 ref|XP_002331427.1| cytochrome P450 [Populus trichocarpa] gi|222... 132 3e-29 emb|CBN88268.1| cytochrome P450 monoxygenase [Medicago truncatul... 130 1e-28 gb|ABC59076.1| cytochrome P450 monooxygenase CYP716A12 [Medicago... 129 2e-28 >gb|AEX07772.1| cytochrome P450 [Catharanthus roseus] gi|365927744|gb|AEX07773.1| cytochrome P450 [Catharanthus roseus] Length = 480 Score = 142 bits (359), Expect = 2e-32 Identities = 71/86 (82%), Positives = 78/86 (90%) Frame = +2 Query: 2 PAQVDELAGPFNLLASGLISIPIDLPGTPFNKGIKASNFVRKKLVSIIKQRKIDLADGKA 181 P +V +L PFN+LASGLIS+PIDLPGTPFN+ IKASN VRK L+SIIKQRKIDLA+GKA Sbjct: 194 PIEVAKLLEPFNVLASGLISVPIDLPGTPFNRAIKASNQVRKMLISIIKQRKIDLAEGKA 253 Query: 182 SPTQDILSHMLLTSDENGKFMQELDI 259 SPTQDILSHMLLTSDENGKFM ELDI Sbjct: 254 SPTQDILSHMLLTSDENGKFMHELDI 279 >ref|XP_002522937.1| cytochrome P450, putative [Ricinus communis] gi|223537831|gb|EEF39448.1| cytochrome P450, putative [Ricinus communis] Length = 480 Score = 132 bits (333), Expect = 2e-29 Identities = 64/86 (74%), Positives = 75/86 (87%) Frame = +2 Query: 2 PAQVDELAGPFNLLASGLISIPIDLPGTPFNKGIKASNFVRKKLVSIIKQRKIDLADGKA 181 P + + A PF LASG+IS+PIDLPGTPF + IKASNF+RK+L+SIIKQRKIDLA+GKA Sbjct: 195 PDHIAKFADPFQELASGIISVPIDLPGTPFRRAIKASNFIRKELISIIKQRKIDLAEGKA 254 Query: 182 SPTQDILSHMLLTSDENGKFMQELDI 259 S TQDILSHMLLTSDE+GKFM E+DI Sbjct: 255 SGTQDILSHMLLTSDEDGKFMNEMDI 280 >ref|XP_002331427.1| cytochrome P450 [Populus trichocarpa] gi|222873641|gb|EEF10772.1| cytochrome P450 [Populus trichocarpa] Length = 481 Score = 132 bits (332), Expect = 3e-29 Identities = 64/86 (74%), Positives = 75/86 (87%) Frame = +2 Query: 2 PAQVDELAGPFNLLASGLISIPIDLPGTPFNKGIKASNFVRKKLVSIIKQRKIDLADGKA 181 P+ V + + PFNLLASG+ISIPIDLPGTPFN+ IKASNF+R +L++ I+QRK DLA+GKA Sbjct: 196 PSHVAKFSDPFNLLASGIISIPIDLPGTPFNRAIKASNFIRTELLAFIRQRKKDLAEGKA 255 Query: 182 SPTQDILSHMLLTSDENGKFMQELDI 259 SPTQDILSHMLLT DENGK M ELDI Sbjct: 256 SPTQDILSHMLLTCDENGKCMNELDI 281 >emb|CBN88268.1| cytochrome P450 monoxygenase [Medicago truncatula] gi|337757425|emb|CBN88269.1| cytochrome P450 monoxygenase [Medicago truncatula] Length = 479 Score = 130 bits (326), Expect = 1e-28 Identities = 62/83 (74%), Positives = 74/83 (89%) Frame = +2 Query: 11 VDELAGPFNLLASGLISIPIDLPGTPFNKGIKASNFVRKKLVSIIKQRKIDLADGKASPT 190 V + + PF L+A+G+IS+PIDLPGTPFNK IKASNF+RK+L+ IIKQR+IDLA+G ASPT Sbjct: 197 VAKFSDPFQLIAAGIISLPIDLPGTPFNKAIKASNFIRKELIKIIKQRRIDLAEGTASPT 256 Query: 191 QDILSHMLLTSDENGKFMQELDI 259 QDILSHMLLTSDENGK M EL+I Sbjct: 257 QDILSHMLLTSDENGKSMNELNI 279 >gb|ABC59076.1| cytochrome P450 monooxygenase CYP716A12 [Medicago truncatula] Length = 479 Score = 129 bits (325), Expect = 2e-28 Identities = 61/83 (73%), Positives = 74/83 (89%) Frame = +2 Query: 11 VDELAGPFNLLASGLISIPIDLPGTPFNKGIKASNFVRKKLVSIIKQRKIDLADGKASPT 190 V + + PF L+A+G+IS+PIDLPGTPFNK IKASNF+RK+L+ IIKQR++DLA+G ASPT Sbjct: 197 VAKFSDPFQLIAAGIISLPIDLPGTPFNKAIKASNFIRKELIKIIKQRRVDLAEGTASPT 256 Query: 191 QDILSHMLLTSDENGKFMQELDI 259 QDILSHMLLTSDENGK M EL+I Sbjct: 257 QDILSHMLLTSDENGKSMNELNI 279