BLASTX nr result
ID: Scutellaria23_contig00017668
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00017668 (351 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271160.1| PREDICTED: probable galacturonosyltransferas... 63 2e-08 ref|XP_003519792.1| PREDICTED: probable galacturonosyltransferas... 63 3e-08 ref|XP_003613432.1| Glycosyltransferase CAZy family GT8 [Medicag... 63 3e-08 ref|XP_002520205.1| transferase, transferring glycosyl groups, p... 63 3e-08 ref|XP_003517873.1| PREDICTED: probable galacturonosyltransferas... 62 5e-08 >ref|XP_002271160.1| PREDICTED: probable galacturonosyltransferase-like 9-like [Vitis vinifera] Length = 386 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/52 (51%), Positives = 37/52 (71%) Frame = -1 Query: 351 KGKPWVRLDDKKACPLDYIWEPYDLFKGTGKVQHTHREVQHLDASSNLVGYS 196 KGKPW RLD +K CP+D++WEPYDL+K + H+++ +SS LVGYS Sbjct: 331 KGKPWSRLDARKPCPVDHLWEPYDLYKPHRNHRLNHQQMLLSASSSTLVGYS 382 >ref|XP_003519792.1| PREDICTED: probable galacturonosyltransferase-like 9-like [Glycine max] Length = 378 Score = 62.8 bits (151), Expect = 3e-08 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = -1 Query: 351 KGKPWVRLDDKKACPLDYIWEPYDLFKGTGKVQHTHREVQHLDASSNLVGYS 196 KGKPWVRLD+KK CPLD +WEPYDL+K +V+ + R+ +SS LVGY+ Sbjct: 326 KGKPWVRLDEKKPCPLDRLWEPYDLYK---QVKDSVRDQNWGFSSSILVGYA 374 >ref|XP_003613432.1| Glycosyltransferase CAZy family GT8 [Medicago truncatula] gi|355514767|gb|AES96390.1| Glycosyltransferase CAZy family GT8 [Medicago truncatula] Length = 395 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/58 (53%), Positives = 40/58 (68%), Gaps = 6/58 (10%) Frame = -1 Query: 351 KGKPWVRLDDKKACPLDYIWEPYDLFKGTGKVQ-----HTHREVQHLDASSN-LVGYS 196 KGKPWVRLD+KKACPLD +WEPYDL+K + +E+Q+ SS+ LVGY+ Sbjct: 334 KGKPWVRLDEKKACPLDSLWEPYDLYKPRNHLMVHGGGDKDQEIQNWSFSSSILVGYA 391 >ref|XP_002520205.1| transferase, transferring glycosyl groups, putative [Ricinus communis] gi|223540697|gb|EEF42260.1| transferase, transferring glycosyl groups, putative [Ricinus communis] Length = 404 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 8/60 (13%) Frame = -1 Query: 351 KGKPWVRLDDKKACPLDYIWEPYDLFK--------GTGKVQHTHREVQHLDASSNLVGYS 196 KGKPWVRLD KK CPLD++WEPYDL+K KV+ H+ + + S+ +GYS Sbjct: 342 KGKPWVRLDAKKPCPLDHLWEPYDLYKVVVYESGDDKNKVKSRHQLLGSSSSQSSFMGYS 401 >ref|XP_003517873.1| PREDICTED: probable galacturonosyltransferase-like 9-like [Glycine max] Length = 378 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/52 (57%), Positives = 38/52 (73%) Frame = -1 Query: 351 KGKPWVRLDDKKACPLDYIWEPYDLFKGTGKVQHTHREVQHLDASSNLVGYS 196 KGKPWVRLD+KK CPLD +WEPYDL+K +V+ R+ +SS LVGY+ Sbjct: 326 KGKPWVRLDEKKPCPLDSLWEPYDLYK---QVKDRVRDQNWGFSSSILVGYA 374