BLASTX nr result
ID: Scutellaria23_contig00017660
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00017660 (495 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001238108.1| uncharacterized protein LOC100499671 [Glycin... 74 8e-12 dbj|BAB41214.1| putative transcriptional coactivator [Brassica r... 74 9e-12 ref|XP_002874654.1| hypothetical protein ARALYDRAFT_489930 [Arab... 74 2e-11 ref|XP_002266998.1| PREDICTED: RNA polymerase II transcriptional... 73 2e-11 emb|CBI34506.3| unnamed protein product [Vitis vinifera] 73 2e-11 >ref|NP_001238108.1| uncharacterized protein LOC100499671 [Glycine max] gi|255625681|gb|ACU13185.1| unknown [Glycine max] Length = 163 Score = 73.9 bits (180), Expect(2) = 8e-12 Identities = 34/42 (80%), Positives = 40/42 (95%) Frame = -1 Query: 495 LSDKRRVTLSEFRGKTLVSIREYYKRDGKELPSTKGMSLTAE 370 LSDKRRVT+ +FRGKTLVSIREYYK+DGKELP++KG+SLT E Sbjct: 100 LSDKRRVTIQDFRGKTLVSIREYYKKDGKELPTSKGISLTEE 141 Score = 20.8 bits (42), Expect(2) = 8e-12 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -3 Query: 277 NIPAIEKAI 251 N+PAIEKAI Sbjct: 149 NVPAIEKAI 157 >dbj|BAB41214.1| putative transcriptional coactivator [Brassica rapa] Length = 165 Score = 74.3 bits (181), Expect = 9e-12 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -1 Query: 495 LSDKRRVTLSEFRGKTLVSIREYYKRDGKELPSTKGMSLTAE 370 LSDKRRVT+ EFRGK+LVSIREYYK+DGKELPS+KG+SLT E Sbjct: 101 LSDKRRVTIQEFRGKSLVSIREYYKKDGKELPSSKGISLTDE 142 >ref|XP_002874654.1| hypothetical protein ARALYDRAFT_489930 [Arabidopsis lyrata subsp. lyrata] gi|297320491|gb|EFH50913.1| hypothetical protein ARALYDRAFT_489930 [Arabidopsis lyrata subsp. lyrata] Length = 165 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/42 (80%), Positives = 40/42 (95%) Frame = -1 Query: 495 LSDKRRVTLSEFRGKTLVSIREYYKRDGKELPSTKGMSLTAE 370 LSDKRRVT+ EF+GKTLVSIREYYK+DGKELP++KG+SLT E Sbjct: 101 LSDKRRVTIQEFKGKTLVSIREYYKKDGKELPTSKGISLTDE 142 >ref|XP_002266998.1| PREDICTED: RNA polymerase II transcriptional coactivator KELP-like [Vitis vinifera] Length = 187 Score = 73.2 bits (178), Expect = 2e-11 Identities = 33/42 (78%), Positives = 41/42 (97%) Frame = -1 Query: 495 LSDKRRVTLSEFRGKTLVSIREYYKRDGKELPSTKGMSLTAE 370 LSD+RRVT+ +FRGKTLVSIRE+Y++DGKELPS+KG+SLTAE Sbjct: 122 LSDRRRVTIQDFRGKTLVSIREFYRKDGKELPSSKGISLTAE 163 >emb|CBI34506.3| unnamed protein product [Vitis vinifera] Length = 142 Score = 73.2 bits (178), Expect = 2e-11 Identities = 33/42 (78%), Positives = 41/42 (97%) Frame = -1 Query: 495 LSDKRRVTLSEFRGKTLVSIREYYKRDGKELPSTKGMSLTAE 370 LSD+RRVT+ +FRGKTLVSIRE+Y++DGKELPS+KG+SLTAE Sbjct: 77 LSDRRRVTIQDFRGKTLVSIREFYRKDGKELPSSKGISLTAE 118