BLASTX nr result
ID: Scutellaria23_contig00017641
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00017641 (301 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532127.1| leucine-rich repeat containing protein, puta... 59 3e-07 >ref|XP_002532127.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223528186|gb|EEF30247.1| leucine-rich repeat containing protein, putative [Ricinus communis] Length = 1142 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/42 (64%), Positives = 37/42 (88%) Frame = +3 Query: 174 MAEAFLQILIENLASLIEEEIGMILGVDKEMKKLSNTLTAIQ 299 MAEAFLQI++ENL SLI+ E+G++LG+DKEM+ LS+ L+ IQ Sbjct: 1 MAEAFLQIVLENLDSLIQNEVGLLLGIDKEMESLSSILSTIQ 42