BLASTX nr result
ID: Scutellaria23_contig00017485
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00017485 (228 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003591018.1| With no lysine kinase [Medicago truncatula] ... 90 2e-16 ref|XP_003536111.1| PREDICTED: serine/threonine-protein kinase W... 88 8e-16 ref|NP_001235958.1| with no lysine kinase 1 [Glycine max] gi|225... 88 8e-16 emb|CBI34208.3| unnamed protein product [Vitis vinifera] 86 3e-15 ref|XP_003633655.1| PREDICTED: serine/threonine-protein kinase W... 86 3e-15 >ref|XP_003591018.1| With no lysine kinase [Medicago truncatula] gi|355480066|gb|AES61269.1| With no lysine kinase [Medicago truncatula] Length = 742 Score = 89.7 bits (221), Expect = 2e-16 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = +1 Query: 85 MNGVIALDSEDSEFVEVDPTGRYGRYNEILGKGSSKTVYRAFDEYEGI 228 MNGV L+ +DSEFVEVDPTGRYGRYNEILGKG+SKTVYRAFDEY+GI Sbjct: 1 MNGVTHLEEDDSEFVEVDPTGRYGRYNEILGKGASKTVYRAFDEYQGI 48 >ref|XP_003536111.1| PREDICTED: serine/threonine-protein kinase WNK1-like [Glycine max] Length = 708 Score = 87.8 bits (216), Expect = 8e-16 Identities = 40/48 (83%), Positives = 45/48 (93%) Frame = +1 Query: 85 MNGVIALDSEDSEFVEVDPTGRYGRYNEILGKGSSKTVYRAFDEYEGI 228 MNGV L+ ++SEFVEVDPTGRYGRYNEILGKG+SKTVYRAFDEY+GI Sbjct: 1 MNGVTHLEPDESEFVEVDPTGRYGRYNEILGKGASKTVYRAFDEYQGI 48 >ref|NP_001235958.1| with no lysine kinase 1 [Glycine max] gi|225348631|gb|ACN87277.1| with no lysine kinase [Glycine max] Length = 698 Score = 87.8 bits (216), Expect = 8e-16 Identities = 40/48 (83%), Positives = 45/48 (93%) Frame = +1 Query: 85 MNGVIALDSEDSEFVEVDPTGRYGRYNEILGKGSSKTVYRAFDEYEGI 228 MNGV L+ ++SEFVEVDPTGRYGRYNEILGKG+SKTVYRAFDEY+GI Sbjct: 1 MNGVTHLEPDESEFVEVDPTGRYGRYNEILGKGASKTVYRAFDEYQGI 48 >emb|CBI34208.3| unnamed protein product [Vitis vinifera] Length = 606 Score = 85.9 bits (211), Expect = 3e-15 Identities = 42/49 (85%), Positives = 46/49 (93%), Gaps = 1/49 (2%) Frame = +1 Query: 85 MNGVIALDSED-SEFVEVDPTGRYGRYNEILGKGSSKTVYRAFDEYEGI 228 MNGVI +++D SEFVEVDPTGRYGRYNEILGKG+SKTVYRAFDEYEGI Sbjct: 1 MNGVINPEADDYSEFVEVDPTGRYGRYNEILGKGASKTVYRAFDEYEGI 49 >ref|XP_003633655.1| PREDICTED: serine/threonine-protein kinase WNK1-like [Vitis vinifera] Length = 743 Score = 85.9 bits (211), Expect = 3e-15 Identities = 42/49 (85%), Positives = 46/49 (93%), Gaps = 1/49 (2%) Frame = +1 Query: 85 MNGVIALDSED-SEFVEVDPTGRYGRYNEILGKGSSKTVYRAFDEYEGI 228 MNGVI +++D SEFVEVDPTGRYGRYNEILGKG+SKTVYRAFDEYEGI Sbjct: 1 MNGVINPEADDYSEFVEVDPTGRYGRYNEILGKGASKTVYRAFDEYEGI 49