BLASTX nr result
ID: Scutellaria23_contig00017484
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00017484 (348 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528523.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 >ref|XP_002528523.1| conserved hypothetical protein [Ricinus communis] gi|223532025|gb|EEF33835.1| conserved hypothetical protein [Ricinus communis] Length = 127 Score = 60.8 bits (146), Expect = 1e-07 Identities = 39/90 (43%), Positives = 52/90 (57%), Gaps = 1/90 (1%) Frame = +3 Query: 81 GMKGLRLNPRRFSVQRLRTNFLCLFRVLKRWKNSYRNCXXXXXXXXXXXKSTSGDERD-S 257 G +G RLN +RFSVQRLR F+ LF++L RWK+SY + +SG +R+ S Sbjct: 20 GGRGFRLNCKRFSVQRLRARFVYLFKLLSRWKSSYGHA---VQSLKRSMSRSSGIKRNTS 76 Query: 258 SVNGVLYGSSYRSGVRTMAHSNSFCSEAIA 347 S ++ S +RT SNSF SEAIA Sbjct: 77 SRRSLVVEVSSDCRMRTFGRSNSFYSEAIA 106