BLASTX nr result
ID: Scutellaria23_contig00017344
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00017344 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_187911.1| major facilitator protein [Arabidopsis thaliana... 56 4e-06 dbj|BAB02515.1| transporter-like protein [Arabidopsis thaliana] 56 4e-06 ref|XP_002882803.1| hypothetical protein ARALYDRAFT_318077 [Arab... 56 4e-06 >ref|NP_187911.1| major facilitator protein [Arabidopsis thaliana] gi|75305942|sp|Q940M4.1|OCT7_ARATH RecName: Full=Organic cation/carnitine transporter 7; Short=AtOCT7 gi|15809988|gb|AAL06921.1| AT3g13050/MGH6_16 [Arabidopsis thaliana] gi|28416475|gb|AAO42768.1| At3g13050/MGH6_16 [Arabidopsis thaliana] gi|332641762|gb|AEE75283.1| major facilitator protein [Arabidopsis thaliana] Length = 500 Score = 55.8 bits (133), Expect = 4e-06 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = -3 Query: 261 AVGLVDSCQQTYAVILFQAMILLSALSVWLSPFETRGRNLTDVIAS 124 AVGLV C QT AV+LF+ +IL+S + V L PFET GR+LTD I++ Sbjct: 446 AVGLVHGCHQTIAVLLFEVVILVSGICVCLFPFETSGRDLTDSISA 491 >dbj|BAB02515.1| transporter-like protein [Arabidopsis thaliana] Length = 470 Score = 55.8 bits (133), Expect = 4e-06 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = -3 Query: 261 AVGLVDSCQQTYAVILFQAMILLSALSVWLSPFETRGRNLTDVIAS 124 AVGLV C QT AV+LF+ +IL+S + V L PFET GR+LTD I++ Sbjct: 416 AVGLVHGCHQTIAVLLFEVVILVSGICVCLFPFETSGRDLTDSISA 461 >ref|XP_002882803.1| hypothetical protein ARALYDRAFT_318077 [Arabidopsis lyrata subsp. lyrata] gi|297328643|gb|EFH59062.1| hypothetical protein ARALYDRAFT_318077 [Arabidopsis lyrata subsp. lyrata] Length = 500 Score = 55.8 bits (133), Expect = 4e-06 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = -3 Query: 261 AVGLVDSCQQTYAVILFQAMILLSALSVWLSPFETRGRNLTDVIAS 124 AVGLV C QT AV+LF+ +IL+S + V L PFET GR+LTD I++ Sbjct: 446 AVGLVHGCHQTIAVLLFEVVILVSGICVCLFPFETSGRDLTDSISA 491