BLASTX nr result
ID: Scutellaria23_contig00017156
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00017156 (218 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280217.1| PREDICTED: lysine histidine transporter 2-li... 56 3e-06 dbj|BAB93110.1| betaine/proline transporter [Avicennia marina] 55 4e-06 >ref|XP_002280217.1| PREDICTED: lysine histidine transporter 2-like [Vitis vinifera] Length = 471 Score = 55.8 bits (133), Expect = 3e-06 Identities = 29/52 (55%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Frame = +2 Query: 65 EEALSDMGATEPNDAVAARSASDD-HTAVEIAETAHQISQDSWFQVGFVLTT 217 EEA+ ++ P+ A A+ + H+AVEI ETAHQIS+DSW QVGFVLTT Sbjct: 23 EEAVQELMMEGPSSESRAPKANGEAHSAVEIPETAHQISKDSWLQVGFVLTT 74 >dbj|BAB93110.1| betaine/proline transporter [Avicennia marina] Length = 440 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +2 Query: 128 SDDHTAVEIAETAHQISQDSWFQVGFVLT 214 SDDH AVEI +TAHQISQDSWFQVG VLT Sbjct: 14 SDDHVAVEIPDTAHQISQDSWFQVGLVLT 42