BLASTX nr result
ID: Scutellaria23_contig00017105
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00017105 (504 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514759.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002514759.1| conserved hypothetical protein [Ricinus communis] gi|223546363|gb|EEF47865.1| conserved hypothetical protein [Ricinus communis] Length = 126 Score = 56.2 bits (134), Expect = 3e-06 Identities = 34/94 (36%), Positives = 49/94 (52%), Gaps = 18/94 (19%) Frame = -2 Query: 455 MSRLFHTSFMLMIISLRLLAFEPHHVYAMTTTDLPIR------------------SAPDE 330 M L H F+L++ + L+F+P V ++T+ DL +R + D Sbjct: 33 MGFLVHRGFLLLLC-IGYLSFQPEKVSSLTSIDLALRLKQELLPVAQNSRMLTTVALDDL 91 Query: 329 VVNTGKKPAATKMVDSNQSSKRTVRRGSDPIHNR 228 T PA + + D NQS+KRTVR+GSDPIHNR Sbjct: 92 QTFTSSAPAPSMVFDPNQSNKRTVRKGSDPIHNR 125