BLASTX nr result
ID: Scutellaria23_contig00016834
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00016834 (592 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317122.1| nbs-lrr resistance protein [Populus trichoca... 54 3e-06 >ref|XP_002317122.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222860187|gb|EEE97734.1| nbs-lrr resistance protein [Populus trichocarpa] Length = 1234 Score = 53.5 bits (127), Expect(2) = 3e-06 Identities = 29/53 (54%), Positives = 36/53 (67%) Frame = -1 Query: 592 LRFKREESEWIRVNESEIRNLSEVEENSILSVLRLSHLSFVLKPFVLKRCFVY 434 +RFKREESEW+RV SE+ NL ++N I+ +LR LSF P LKRCF Y Sbjct: 419 MRFKREESEWLRVQGSELLNLDR-QDNKIIQILR---LSFDHLPSNLKRCFAY 467 Score = 22.7 bits (47), Expect(2) = 3e-06 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 384 LKRCFVYYAIF 352 LKRCF Y A+F Sbjct: 461 LKRCFAYCAVF 471