BLASTX nr result
ID: Scutellaria23_contig00016708
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00016708 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAA01974.1| chloroplast elongation factor TuA (EF-TuA) [Nico... 83 2e-14 gb|ABH07510.1| chloroplast translation elongation factor [Nicoti... 83 2e-14 dbj|BAA01975.1| chloroplast elongation factor TuB (EF-TuB) [Nico... 83 2e-14 sp|Q40450.2|EFTUA_NICSY RecName: Full=Elongation factor TuA, chl... 83 2e-14 sp|Q43364.1|EFTUB_NICSY RecName: Full=Elongation factor TuB, chl... 83 2e-14 >dbj|BAA01974.1| chloroplast elongation factor TuA (EF-TuA) [Nicotiana sylvestris] Length = 457 Score = 83.2 bits (204), Expect = 2e-14 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -3 Query: 121 RRFSVRAARGKFERKKPHVNIGTIGHVDHGKTTLTAALTM 2 RRF+VRAARGKFERKKPHVNIGTIGHVDHGKTTLTAALTM Sbjct: 64 RRFTVRAARGKFERKKPHVNIGTIGHVDHGKTTLTAALTM 103 >gb|ABH07510.1| chloroplast translation elongation factor [Nicotiana attenuata] Length = 311 Score = 83.2 bits (204), Expect = 2e-14 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -3 Query: 121 RRFSVRAARGKFERKKPHVNIGTIGHVDHGKTTLTAALTM 2 RRF+VRAARGKFERKKPHVNIGTIGHVDHGKTTLTAALTM Sbjct: 71 RRFTVRAARGKFERKKPHVNIGTIGHVDHGKTTLTAALTM 110 >dbj|BAA01975.1| chloroplast elongation factor TuB (EF-TuB) [Nicotiana sylvestris] Length = 425 Score = 83.2 bits (204), Expect = 2e-14 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -3 Query: 121 RRFSVRAARGKFERKKPHVNIGTIGHVDHGKTTLTAALTM 2 RRF+VRAARGKFERKKPHVNIGTIGHVDHGKTTLTAALTM Sbjct: 11 RRFTVRAARGKFERKKPHVNIGTIGHVDHGKTTLTAALTM 50 >sp|Q40450.2|EFTUA_NICSY RecName: Full=Elongation factor TuA, chloroplastic; Short=EF-TuA; Flags: Precursor gi|68566318|sp|P68158.1|EFTU_TOBAC RecName: Full=Elongation factor Tu, chloroplastic; Short=EF-Tu; Flags: Precursor gi|170344|gb|AAA18546.1| translation elongation factor EF-Tu [Nicotiana tabacum] gi|459239|dbj|BAA02027.1| chloroplast elongation factor TuA(EF-TuA) [Nicotiana sylvestris] Length = 478 Score = 83.2 bits (204), Expect = 2e-14 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -3 Query: 121 RRFSVRAARGKFERKKPHVNIGTIGHVDHGKTTLTAALTM 2 RRF+VRAARGKFERKKPHVNIGTIGHVDHGKTTLTAALTM Sbjct: 64 RRFTVRAARGKFERKKPHVNIGTIGHVDHGKTTLTAALTM 103 >sp|Q43364.1|EFTUB_NICSY RecName: Full=Elongation factor TuB, chloroplastic; Short=EF-TuB; Flags: Precursor gi|459241|dbj|BAA02028.1| chloroplast elongation factor TuB(EF-TuB) [Nicotiana sylvestris] Length = 485 Score = 83.2 bits (204), Expect = 2e-14 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -3 Query: 121 RRFSVRAARGKFERKKPHVNIGTIGHVDHGKTTLTAALTM 2 RRF+VRAARGKFERKKPHVNIGTIGHVDHGKTTLTAALTM Sbjct: 71 RRFTVRAARGKFERKKPHVNIGTIGHVDHGKTTLTAALTM 110