BLASTX nr result
ID: Scutellaria23_contig00016653
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00016653 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002332640.1| predicted protein [Populus trichocarpa] gi|2... 63 2e-08 ref|XP_002512378.1| Kinesin-3, putative [Ricinus communis] gi|22... 55 5e-06 >ref|XP_002332640.1| predicted protein [Populus trichocarpa] gi|222832867|gb|EEE71344.1| predicted protein [Populus trichocarpa] Length = 338 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +3 Query: 3 SWKPKHPTVIALQKKHLVWSPLKLKSMKNKRNSLLY*SSAPT 128 SWKPKHPTV+ALQ+K LVWSPLKL+S +N+R SLL S+ T Sbjct: 168 SWKPKHPTVVALQRKSLVWSPLKLRSFQNRRPSLLPYRSSST 209 >ref|XP_002512378.1| Kinesin-3, putative [Ricinus communis] gi|223548339|gb|EEF49830.1| Kinesin-3, putative [Ricinus communis] Length = 786 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +3 Query: 6 WKPKHPTVIALQKKHLVWSPLKLKSMKNKRNS 101 WKP+HPTV+ALQ+K LVWSPLKL+ KN R S Sbjct: 743 WKPRHPTVVALQRKSLVWSPLKLRGPKNYRKS 774