BLASTX nr result
ID: Scutellaria23_contig00016244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00016244 (172 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEB97385.1| MAX2B [Petunia x hybrida] 61 1e-07 gb|AEB97384.1| MAX2A [Petunia x hybrida] 59 5e-07 >gb|AEB97385.1| MAX2B [Petunia x hybrida] Length = 723 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/51 (54%), Positives = 38/51 (74%) Frame = +1 Query: 19 NNDSMRSASKKCKYSYDLNASYVELDVNSNSNGHDVRTWEKLRYLSLWIAV 171 ++D M + +K+CKYSYDLN+ YVE N + NG RTW++L+YLSLWI V Sbjct: 489 DDDLMNNRNKRCKYSYDLNSVYVEN--NGHGNGFCGRTWDRLQYLSLWIGV 537 >gb|AEB97384.1| MAX2A [Petunia x hybrida] Length = 708 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +1 Query: 10 FDCNNDS-MRSASKKCKYSYDLNASYVELDVNSNSNGHDVRTWEKLRYLSLWIAV 171 F C D+ + K+CK+SYDLN+ Y E VN + NG+ R+W++L+YLSLWI V Sbjct: 470 FGCEEDAYLFKEKKRCKFSYDLNSLYEE--VNGHGNGYSGRSWDRLQYLSLWIGV 522