BLASTX nr result
ID: Scutellaria23_contig00015933
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00015933 (340 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301384.1| predicted protein [Populus trichocarpa] gi|2... 67 1e-09 ref|NP_001189756.1| protein ABIL1 [Arabidopsis thaliana] gi|3302... 67 2e-09 ref|NP_001118534.1| protein ABIL1 [Arabidopsis thaliana] gi|3302... 67 2e-09 ref|NP_566067.1| protein ABIL1 [Arabidopsis thaliana] gi|7516048... 67 2e-09 ref|XP_003548613.1| PREDICTED: protein ABIL1-like [Glycine max] 66 3e-09 >ref|XP_002301384.1| predicted protein [Populus trichocarpa] gi|222843110|gb|EEE80657.1| predicted protein [Populus trichocarpa] Length = 306 Score = 67.0 bits (162), Expect = 1e-09 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = +2 Query: 2 SKPLTPHRSFDNLTQREIIRTPVRSKSVLSAFFVKQKTPKLKSGA 136 SKPLT RSFDN + EI+R PVRSKS+LSAFFVKQKTPKLK+G+ Sbjct: 261 SKPLTAFRSFDN-PRHEIVRAPVRSKSMLSAFFVKQKTPKLKAGS 304 >ref|NP_001189756.1| protein ABIL1 [Arabidopsis thaliana] gi|330255567|gb|AEC10661.1| protein ABIL1 [Arabidopsis thaliana] Length = 286 Score = 66.6 bits (161), Expect = 2e-09 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +2 Query: 5 KPLTPHRSFDNLTQREIIRTPVRSKSVLSAFFVKQKTPKLKSG 133 K LT HRS DN +REII+ PVR+KSVLSAFFVKQKTPKLK+G Sbjct: 241 KLLTAHRSLDNNPRREIIQAPVRTKSVLSAFFVKQKTPKLKAG 283 >ref|NP_001118534.1| protein ABIL1 [Arabidopsis thaliana] gi|330255566|gb|AEC10660.1| protein ABIL1 [Arabidopsis thaliana] Length = 329 Score = 66.6 bits (161), Expect = 2e-09 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +2 Query: 5 KPLTPHRSFDNLTQREIIRTPVRSKSVLSAFFVKQKTPKLKSG 133 K LT HRS DN +REII+ PVR+KSVLSAFFVKQKTPKLK+G Sbjct: 284 KLLTAHRSLDNNPRREIIQAPVRTKSVLSAFFVKQKTPKLKAG 326 >ref|NP_566067.1| protein ABIL1 [Arabidopsis thaliana] gi|75160480|sp|Q8S8M5.1|ABIL1_ARATH RecName: Full=Protein ABIL1; AltName: Full=Abl interactor-like protein 1; Short=AtABIL1 gi|20197375|gb|AAM15048.1| expressed protein [Arabidopsis thaliana] gi|21537358|gb|AAM61699.1| unknown [Arabidopsis thaliana] gi|57240092|gb|AAW49256.1| Abl interactor-like protein-1 [Arabidopsis thaliana] gi|108385243|gb|ABF85765.1| At2g46225 [Arabidopsis thaliana] gi|330255565|gb|AEC10659.1| protein ABIL1 [Arabidopsis thaliana] Length = 298 Score = 66.6 bits (161), Expect = 2e-09 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +2 Query: 5 KPLTPHRSFDNLTQREIIRTPVRSKSVLSAFFVKQKTPKLKSG 133 K LT HRS DN +REII+ PVR+KSVLSAFFVKQKTPKLK+G Sbjct: 253 KLLTAHRSLDNNPRREIIQAPVRTKSVLSAFFVKQKTPKLKAG 295 >ref|XP_003548613.1| PREDICTED: protein ABIL1-like [Glycine max] Length = 311 Score = 66.2 bits (160), Expect = 3e-09 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = +2 Query: 2 SKPLTPHRSFDNLTQREIIRTPVRSKSVLSAFFVKQKTPKLKSGA 136 SKPLT RSFD +RE ++ P RSKSVLSAFFVKQKTPKLK+G+ Sbjct: 265 SKPLTAFRSFDYQNRRETVQVPTRSKSVLSAFFVKQKTPKLKAGS 309