BLASTX nr result
ID: Scutellaria23_contig00015863
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00015863 (409 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004173282.1| PREDICTED: histone H2B.1-like, partial [Cucu... 64 1e-08 ref|XP_004169072.1| PREDICTED: LOW QUALITY PROTEIN: histone H2B-... 64 1e-08 ref|XP_004156571.1| PREDICTED: histone H2B.4-like [Cucumis sativus] 64 1e-08 ref|XP_004143285.1| PREDICTED: histone H2B.4-like [Cucumis sativ... 64 1e-08 ref|XP_004143093.1| PREDICTED: probable histone H2B.1-like [Cucu... 64 1e-08 >ref|XP_004173282.1| PREDICTED: histone H2B.1-like, partial [Cucumis sativus] Length = 83 Score = 63.9 bits (154), Expect = 1e-08 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 3 SREIQTAVRLVLPGELAKHAVSEGTKAVTKFT 98 SREIQTAVRLVLPGELAKHAVSEGTKAVTKFT Sbjct: 50 SREIQTAVRLVLPGELAKHAVSEGTKAVTKFT 81 >ref|XP_004169072.1| PREDICTED: LOW QUALITY PROTEIN: histone H2B-like [Cucumis sativus] Length = 142 Score = 63.9 bits (154), Expect = 1e-08 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 3 SREIQTAVRLVLPGELAKHAVSEGTKAVTKFT 98 SREIQTAVRLVLPGELAKHAVSEGTKAVTKFT Sbjct: 109 SREIQTAVRLVLPGELAKHAVSEGTKAVTKFT 140 >ref|XP_004156571.1| PREDICTED: histone H2B.4-like [Cucumis sativus] Length = 138 Score = 63.9 bits (154), Expect = 1e-08 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 3 SREIQTAVRLVLPGELAKHAVSEGTKAVTKFT 98 SREIQTAVRLVLPGELAKHAVSEGTKAVTKFT Sbjct: 105 SREIQTAVRLVLPGELAKHAVSEGTKAVTKFT 136 >ref|XP_004143285.1| PREDICTED: histone H2B.4-like [Cucumis sativus] gi|449482391|ref|XP_004156268.1| PREDICTED: histone H2B.4-like [Cucumis sativus] Length = 139 Score = 63.9 bits (154), Expect = 1e-08 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 3 SREIQTAVRLVLPGELAKHAVSEGTKAVTKFT 98 SREIQTAVRLVLPGELAKHAVSEGTKAVTKFT Sbjct: 106 SREIQTAVRLVLPGELAKHAVSEGTKAVTKFT 137 >ref|XP_004143093.1| PREDICTED: probable histone H2B.1-like [Cucumis sativus] gi|449508145|ref|XP_004163232.1| PREDICTED: probable histone H2B.1-like [Cucumis sativus] Length = 152 Score = 63.9 bits (154), Expect = 1e-08 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 3 SREIQTAVRLVLPGELAKHAVSEGTKAVTKFT 98 SREIQTAVRLVLPGELAKHAVSEGTKAVTKFT Sbjct: 119 SREIQTAVRLVLPGELAKHAVSEGTKAVTKFT 150