BLASTX nr result
ID: Scutellaria23_contig00015819
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00015819 (1525 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004143925.1| PREDICTED: uncharacterized protein LOC101223... 64 8e-08 >ref|XP_004143925.1| PREDICTED: uncharacterized protein LOC101223188 [Cucumis sativus] gi|449495846|ref|XP_004159962.1| PREDICTED: uncharacterized protein LOC101226976 [Cucumis sativus] Length = 853 Score = 64.3 bits (155), Expect = 8e-08 Identities = 43/128 (33%), Positives = 65/128 (50%), Gaps = 8/128 (6%) Frame = +1 Query: 739 ISEDTQLCYDFGDAWSDP-LKFAVKTLMGDLSMNDSLTFPSCLNE--QQNRTQAGECLQQ 909 ++ + L + FGD+W+DP L FA KTL G + ++DSL S E + +R+Q Sbjct: 729 MTSEVPLSFPFGDSWADPCLDFAFKTLTGAIPIDDSLEIQSFFEERLESSRSQKDSSPAL 788 Query: 910 PQLDAPNIFQNALPSRSES-----SKQHGAVDQLPPISSSFSTLENIGFPSFGGFNCQSS 1074 P +PN+FQN + S + S QH ++D P +S L N+ PS GF Q Sbjct: 789 PDFGSPNLFQNDISSHFDGPEKSVSGQHLSLD--PQLS-----LGNVSLPSCSGFTSQQQ 841 Query: 1075 TQVGKKDS 1098 + V + S Sbjct: 842 SSVDRNRS 849