BLASTX nr result
ID: Scutellaria23_contig00015602
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00015602 (283 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632589.1| PREDICTED: wound-induced protein 1-like [Vit... 61 8e-08 ref|XP_002533790.1| Wound-induced protein, putative [Ricinus com... 57 1e-06 ref|XP_003623517.1| Wound-induced protein [Medicago truncatula] ... 57 2e-06 ref|XP_003623511.1| Wound-induced protein [Medicago truncatula] ... 57 2e-06 ref|XP_003623505.1| Wound-induced protein [Medicago truncatula] ... 57 2e-06 >ref|XP_003632589.1| PREDICTED: wound-induced protein 1-like [Vitis vinifera] Length = 159 Score = 61.2 bits (147), Expect = 8e-08 Identities = 33/52 (63%), Positives = 40/52 (76%), Gaps = 2/52 (3%) Frame = +3 Query: 3 ITQFREYFNTWLTVQGLKPMAKCMR--STTLWRSHPHDVANRRSLPELMLAI 152 ITQFREYFNTWLTV+ L+P +R S TLW+S P D+A +RSLP L+LAI Sbjct: 109 ITQFREYFNTWLTVRDLRPAEWEVRHESPTLWQSQPRDLA-KRSLPGLLLAI 159 >ref|XP_002533790.1| Wound-induced protein, putative [Ricinus communis] gi|223526279|gb|EEF28592.1| Wound-induced protein, putative [Ricinus communis] Length = 154 Score = 57.4 bits (137), Expect = 1e-06 Identities = 31/54 (57%), Positives = 37/54 (68%), Gaps = 4/54 (7%) Frame = +3 Query: 3 ITQFREYFNTWLTVQGLKPMAKC----MRSTTLWRSHPHDVANRRSLPELMLAI 152 ITQFREYFNTWLTV+ + P + S TLW+S P D+ N RSLP L+LAI Sbjct: 102 ITQFREYFNTWLTVKDMSPQQRWEIGRESSHTLWQSQPRDLFN-RSLPGLLLAI 154 >ref|XP_003623517.1| Wound-induced protein [Medicago truncatula] gi|355498532|gb|AES79735.1| Wound-induced protein [Medicago truncatula] Length = 151 Score = 57.0 bits (136), Expect = 2e-06 Identities = 31/53 (58%), Positives = 37/53 (69%), Gaps = 3/53 (5%) Frame = +3 Query: 3 ITQFREYFNTWLTVQGLKPMA---KCMRSTTLWRSHPHDVANRRSLPELMLAI 152 ITQFREYFNTWL V+ L+P+ + TLWRS P D+ RRSLP L+LAI Sbjct: 100 ITQFREYFNTWLVVRDLRPLRWEDHKQDNMTLWRSQPRDL-YRRSLPGLVLAI 151 >ref|XP_003623511.1| Wound-induced protein [Medicago truncatula] gi|355498526|gb|AES79729.1| Wound-induced protein [Medicago truncatula] gi|388495486|gb|AFK35809.1| unknown [Medicago truncatula] Length = 151 Score = 57.0 bits (136), Expect = 2e-06 Identities = 31/53 (58%), Positives = 37/53 (69%), Gaps = 3/53 (5%) Frame = +3 Query: 3 ITQFREYFNTWLTVQGLKPMA---KCMRSTTLWRSHPHDVANRRSLPELMLAI 152 ITQFREYFNTWL V+ L+P+ + TLWRS P D+ RRSLP L+LAI Sbjct: 100 ITQFREYFNTWLVVRDLRPLRWEDHKQDNMTLWRSQPRDL-YRRSLPGLVLAI 151 >ref|XP_003623505.1| Wound-induced protein [Medicago truncatula] gi|355498520|gb|AES79723.1| Wound-induced protein [Medicago truncatula] Length = 151 Score = 57.0 bits (136), Expect = 2e-06 Identities = 31/53 (58%), Positives = 37/53 (69%), Gaps = 3/53 (5%) Frame = +3 Query: 3 ITQFREYFNTWLTVQGLKPMA---KCMRSTTLWRSHPHDVANRRSLPELMLAI 152 ITQFREYFNTWL V+ L+P+ + TLWRS P D+ RRSLP L+LAI Sbjct: 100 ITQFREYFNTWLVVRDLRPLRWEDHKQDNMTLWRSQPRDL-YRRSLPGLVLAI 151