BLASTX nr result
ID: Scutellaria23_contig00015457
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00015457 (447 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533560.1| RING-H2 finger protein ATL5H precursor, puta... 77 1e-12 ref|XP_002512343.1| ring finger protein, putative [Ricinus commu... 73 2e-11 ref|XP_004139190.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-... 71 8e-11 gb|AAO45753.1| RING/c3HC4/PHD zinc finger-like protein [Cucumis ... 70 1e-10 ref|XP_003626315.1| RING finger protein [Medicago truncatula] gi... 70 2e-10 >ref|XP_002533560.1| RING-H2 finger protein ATL5H precursor, putative [Ricinus communis] gi|223526560|gb|EEF28817.1| RING-H2 finger protein ATL5H precursor, putative [Ricinus communis] Length = 267 Score = 77.4 bits (189), Expect = 1e-12 Identities = 39/65 (60%), Positives = 47/65 (72%), Gaps = 1/65 (1%) Frame = +1 Query: 256 SIYIHQCSNSQPYRRAAAAR-GLNPSVIETFPTLSYSEVKDQCRALECTVCLKEFEVNET 432 SI+I QCS+S+P A + R GL+P VIE FP L YS VKD + LEC +CL EFE +ET Sbjct: 68 SIFIRQCSDSEPRIVAGSKRVGLDPDVIEKFPVLVYSHVKDHVKILECAICLSEFEDDET 127 Query: 433 LRLLP 447 LRLLP Sbjct: 128 LRLLP 132 >ref|XP_002512343.1| ring finger protein, putative [Ricinus communis] gi|223548304|gb|EEF49795.1| ring finger protein, putative [Ricinus communis] Length = 380 Score = 73.2 bits (178), Expect = 2e-11 Identities = 45/79 (56%), Positives = 50/79 (63%), Gaps = 15/79 (18%) Frame = +1 Query: 256 SIYIHQCSNSQP------------YRRAAAARGLNPSVIETFPTLSYSEVKD---QCRAL 390 S+YI C+NS RRAAAARGL+ +VIETFPTL YSEVK AL Sbjct: 62 SVYIRHCANSSNGVSVQGLANGGRSRRAAAARGLDAAVIETFPTLVYSEVKGLKIGKGAL 121 Query: 391 ECTVCLKEFEVNETLRLLP 447 EC VCL EFE +ETLRLLP Sbjct: 122 ECAVCLCEFEDDETLRLLP 140 >ref|XP_004139190.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-like [Cucumis sativus] gi|449518671|ref|XP_004166360.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-like [Cucumis sativus] Length = 379 Score = 71.2 bits (173), Expect = 8e-11 Identities = 40/77 (51%), Positives = 49/77 (63%), Gaps = 13/77 (16%) Frame = +1 Query: 256 SIYIHQCSNSQPY----------RRAAAARGLNPSVIETFPTLSYSEVKDQ---CRALEC 396 S+YI C++SQ R A RGL+P+VIETFPTL YS+VK+ ALEC Sbjct: 65 SVYIRHCNDSQSNTIRPITVAAGRSRRATRGLDPAVIETFPTLIYSDVKEHKIGKSALEC 124 Query: 397 TVCLKEFEVNETLRLLP 447 VCL EFE +ETLRL+P Sbjct: 125 AVCLNEFEDDETLRLIP 141 >gb|AAO45753.1| RING/c3HC4/PHD zinc finger-like protein [Cucumis melo subsp. melo] Length = 379 Score = 70.5 bits (171), Expect = 1e-10 Identities = 41/77 (53%), Positives = 51/77 (66%), Gaps = 13/77 (16%) Frame = +1 Query: 256 SIYIHQCSNS-----QPYRRAA-----AARGLNPSVIETFPTLSYSEVKDQ---CRALEC 396 S+YI C++S +P AA A RGL+P+VIETFPTL YS+VK+ ALEC Sbjct: 65 SVYIRHCNDSPSNTVRPITAAAGRSRRATRGLDPAVIETFPTLIYSDVKEHKIGKSALEC 124 Query: 397 TVCLKEFEVNETLRLLP 447 VCL EFE +ETLRL+P Sbjct: 125 AVCLNEFEDDETLRLIP 141 >ref|XP_003626315.1| RING finger protein [Medicago truncatula] gi|87240525|gb|ABD32383.1| Zinc finger, RING-type [Medicago truncatula] gi|355501330|gb|AES82533.1| RING finger protein [Medicago truncatula] Length = 361 Score = 69.7 bits (169), Expect = 2e-10 Identities = 42/76 (55%), Positives = 46/76 (60%), Gaps = 12/76 (15%) Frame = +1 Query: 256 SIYIHQCSNSQPYR---------RAAAARGLNPSVIETFPTLSYSEVKDQ---CRALECT 399 SIYI +CS+S R A ARGL+PSVIETFP L YSEVK LEC Sbjct: 62 SIYIRRCSDSPSSNNLLLPITNGRRAVARGLDPSVIETFPILEYSEVKIHKIGKDVLECA 121 Query: 400 VCLKEFEVNETLRLLP 447 VCL EFE ETLRL+P Sbjct: 122 VCLMEFEDTETLRLIP 137