BLASTX nr result
ID: Scutellaria23_contig00015275
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00015275 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEO33588.1| hypothetical protein [Amblyomma maculatum] 58 9e-07 >gb|AEO33588.1| hypothetical protein [Amblyomma maculatum] Length = 228 Score = 57.8 bits (138), Expect = 9e-07 Identities = 31/52 (59%), Positives = 38/52 (73%) Frame = +2 Query: 134 PPFSNRYREPEFASSISVFDRLVQIDSQPAMNPEYDYLFKLLLIGDSGVGKS 289 P F +++ P F +S + R + +S PAMNPEYDYLFKLLLIGDSGVGKS Sbjct: 9 PQFYSQFGNPNFPNSPAKGYRSSRQNS-PAMNPEYDYLFKLLLIGDSGVGKS 59