BLASTX nr result
ID: Scutellaria23_contig00014929
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00014929 (506 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_01227368.1| hypothetical protein SI859A1_01496 [Aurantimo... 112 1e-30 ref|ZP_05822977.1| LOW QUALITY PROTEIN: conserved hypothetical p... 84 9e-25 ref|YP_005415573.1| hypothetical protein RSPPHO_03264, partial [... 86 1e-24 ref|ZP_06097396.1| LOW QUALITY PROTEIN: conserved hypothetical p... 80 2e-23 gb|ADI18616.1| hypothetical protein [uncultured Rhodospirillales... 111 5e-23 >ref|ZP_01227368.1| hypothetical protein SI859A1_01496 [Aurantimonas manganoxydans SI85-9A1] gi|90336395|gb|EAS50136.1| hypothetical protein SI859A1_01496 [Aurantimonas manganoxydans SI85-9A1] Length = 100 Score = 112 bits (281), Expect(2) = 1e-30 Identities = 56/70 (80%), Positives = 59/70 (84%) Frame = +1 Query: 1 STCSWLDH*VSGLIQRT*RPIQTRFRYAFAYRLKLAR*IKSLAHNTKGTMSPRTYLGLHL 180 STCSWLDH VSGLI+RT RP+QTRFRYA YRLKLAR KSL H TKGTMSPRT L LHL Sbjct: 7 STCSWLDHSVSGLIRRTERPVQTRFRYASTYRLKLARQTKSLTHYTKGTMSPRTNLELHL 66 Query: 181 FVGVRFQVYF 210 FVG+RFQV F Sbjct: 67 FVGIRFQVLF 76 Score = 45.8 bits (107), Expect(2) = 1e-30 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = +3 Query: 204 LFHSPRRGAFHLSLTVLVHYRSLRST 281 LFHSP RGAFHLSLTVLV YRS ST Sbjct: 75 LFHSPCRGAFHLSLTVLVRYRSCTST 100 >ref|ZP_05822977.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella abortus NCTC 8038] gi|260565852|ref|ZP_05836334.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] gi|260568930|ref|ZP_05839397.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|261219757|ref|ZP_05934038.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella ceti M13/05/1] gi|261313975|ref|ZP_05953172.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella pinnipedialis M163/99/10] gi|261316147|ref|ZP_05955344.1| LOW QUALITY PROTEIN: conserved hypothetical protein, partial [Brucella pinnipedialis B2/94] gi|261322646|ref|ZP_05961843.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella ceti M644/93/1] gi|260095406|gb|EEW79285.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella abortus NCTC 8038] gi|260151028|gb|EEW86124.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] gi|260154116|gb|EEW89199.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|260924846|gb|EEX91414.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella ceti M13/05/1] gi|261295336|gb|EEX98832.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella ceti M644/93/1] gi|261295370|gb|EEX98866.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella pinnipedialis B2/94] gi|261303001|gb|EEY06498.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella pinnipedialis M163/99/10] Length = 135 Score = 84.3 bits (207), Expect(2) = 9e-25 Identities = 41/53 (77%), Positives = 44/53 (83%) Frame = +2 Query: 188 VSGFRSISLPSPGCFSPFPHGTGSLSVAEEYLGLEGGPPMFRQDCTCPALLVD 346 VSG ++SLPS GCFSPFPHGTGSLSV EYLGL+ G PMFRQD TCPALL D Sbjct: 26 VSG--TVSLPSSGCFSPFPHGTGSLSVMHEYLGLDRGRPMFRQDFTCPALLKD 76 Score = 54.3 bits (129), Expect(2) = 9e-25 Identities = 27/45 (60%), Positives = 29/45 (64%) Frame = +1 Query: 370 GYHPLRPSFPDWFRLSLMYHWPGPRSLATTNGVSVDVLSSRYLDV 504 G P F + F HWPGPRSLATT+GVS DVLSS YLDV Sbjct: 84 GLSPTSVEFSNSFHFIHKSHWPGPRSLATTSGVSFDVLSSGYLDV 128 >ref|YP_005415573.1| hypothetical protein RSPPHO_03264, partial [Rhodospirillum photometricum DSM 122] gi|378401487|emb|CCG06603.1| unnamed protein product, partial [Rhodospirillum photometricum DSM 122] Length = 114 Score = 86.3 bits (212), Expect(2) = 1e-24 Identities = 47/70 (67%), Positives = 51/70 (72%) Frame = +1 Query: 1 STCSWLDH*VSGLIQRT*RPIQTRFRYAFAYRLKLAR*IKSLAHNTKGTMSPRTYLGLHL 180 STC WLDH VSGLI+RT RP++TRFR A YRLKLAR IKSL H TKGT SP L L Sbjct: 23 STCPWLDHPVSGLIRRTRRPLKTRFRCASTYRLKLARQIKSLTHYTKGTPSPPK--ELRL 80 Query: 181 FVGVRFQVYF 210 VG+RFQ F Sbjct: 81 LVGIRFQELF 90 Score = 52.0 bits (123), Expect(2) = 1e-24 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +3 Query: 204 LFHSPRRGAFHLSLTVLVHYRSLRST 281 LFHSP RGAFHLSLTVLVHYRS RST Sbjct: 89 LFHSPHRGAFHLSLTVLVHYRSSRST 114 >ref|ZP_06097396.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella sp. 83/13] gi|264663253|gb|EEZ33514.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella sp. 83/13] Length = 135 Score = 80.1 bits (196), Expect(2) = 2e-23 Identities = 40/53 (75%), Positives = 43/53 (81%) Frame = +2 Query: 188 VSGFRSISLPSPGCFSPFPHGTGSLSVAEEYLGLEGGPPMFRQDCTCPALLVD 346 VSG ++SLPS G FSPFPHGTGSLSV EYLGL+ G PMFRQD TCPALL D Sbjct: 26 VSG--TVSLPSSGYFSPFPHGTGSLSVMHEYLGLDRGRPMFRQDFTCPALLKD 76 Score = 54.3 bits (129), Expect(2) = 2e-23 Identities = 27/45 (60%), Positives = 29/45 (64%) Frame = +1 Query: 370 GYHPLRPSFPDWFRLSLMYHWPGPRSLATTNGVSVDVLSSRYLDV 504 G P F + F HWPGPRSLATT+GVS DVLSS YLDV Sbjct: 84 GLSPTSVEFSNSFHFIHKSHWPGPRSLATTSGVSFDVLSSGYLDV 128 >gb|ADI18616.1| hypothetical protein [uncultured Rhodospirillales bacterium HF4000_24M03] Length = 90 Score = 111 bits (278), Expect = 5e-23 Identities = 57/90 (63%), Positives = 62/90 (68%) Frame = +1 Query: 226 VLFTFPSRYWFTIGR*GVLRLGGWSPHVQTGLHVSRLTRGYIIALLVRGYHPLRPSFPDW 405 +LFTFPSRYW+TIGR GVLRLGGWSPHVQTG HVSR TR G P Sbjct: 1 MLFTFPSRYWYTIGRQGVLRLGGWSPHVQTGFHVSRPTRVQQTTDTHTGLSPSMAGLSRP 60 Query: 406 FRLSLMYHWPGPRSLATTNGVSVDVLSSRY 495 F L + + WPGPRSLA T+GVSVDVLSS Y Sbjct: 61 FWLIVCWRWPGPRSLAATDGVSVDVLSSSY 90