BLASTX nr result
ID: Scutellaria23_contig00014846
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00014846 (1070 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28047.3| unnamed protein product [Vitis vinifera] 63 1e-07 >emb|CBI28047.3| unnamed protein product [Vitis vinifera] Length = 337 Score = 63.2 bits (152), Expect = 1e-07 Identities = 30/48 (62%), Positives = 33/48 (68%), Gaps = 5/48 (10%) Frame = -2 Query: 1069 GGGGAGSDYEPGEVRRDPPPYSRSHRCDN-----LPDARIWVLRKPCW 941 GGG GSDYEPGE+RR+ P YSRS R + LP RIWVLRK CW Sbjct: 28 GGGTGGSDYEPGELRREAPHYSRSDRFGDGPALMLPGTRIWVLRKACW 75