BLASTX nr result
ID: Scutellaria23_contig00014600
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00014600 (236 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007353950.1| ribosomal protein S8 (chloroplast) [Tectona ... 141 5e-32 ref|YP_007507147.1| ribosomal protein S8 (chloroplast) [Salvia m... 139 2e-31 gb|ADD29864.1| ribosomal protein S8 [Antirrhinum majus] 138 5e-31 ref|YP_004935702.1| rps8 gene product (chloroplast) [Sesamum ind... 137 9e-31 gb|ABI15138.1| ribosomal protein S8 (chloroplast) [Gratiola virg... 135 5e-30 >ref|YP_007353950.1| ribosomal protein S8 (chloroplast) [Tectona grandis] gi|438687639|emb|CCP47166.1| ribosomal protein S8 (chloroplast) [Tectona grandis] gi|438688323|emb|CCP47255.1| ribosomal protein S8 (chloroplast) [Tectona grandis] gi|438688447|emb|CCP47344.1| ribosomal protein S8 (chloroplast) [Tectona grandis] Length = 134 Score = 141 bits (356), Expect = 5e-32 Identities = 72/76 (94%), Positives = 74/76 (97%) Frame = -2 Query: 229 KKNKNFLVLTLRHRRNRKRPHPYRNFLNLKRISRPGLRIYSNSQRIPRILGGMGVVILST 50 +KNKNFLVLTLRHRRNRKRP YRNFLNLKRISRPGLRIYSNSQRIPRILGGMG+VILST Sbjct: 53 EKNKNFLVLTLRHRRNRKRP--YRNFLNLKRISRPGLRIYSNSQRIPRILGGMGIVILST 110 Query: 49 SRGIMTDREARLEGIG 2 SRGIMTDREARLEGIG Sbjct: 111 SRGIMTDREARLEGIG 126 >ref|YP_007507147.1| ribosomal protein S8 (chloroplast) [Salvia miltiorrhiza] gi|401879777|gb|AFQ30964.1| ribosomal protein S8 (chloroplast) [Salvia miltiorrhiza] Length = 134 Score = 139 bits (350), Expect = 2e-31 Identities = 71/76 (93%), Positives = 73/76 (96%) Frame = -2 Query: 229 KKNKNFLVLTLRHRRNRKRPHPYRNFLNLKRISRPGLRIYSNSQRIPRILGGMGVVILST 50 +KNKNFLVLTLRH RNRKRP YRNFLNLKRISRPGLRIYSNSQRIPRILGGMG+VILST Sbjct: 53 EKNKNFLVLTLRHSRNRKRP--YRNFLNLKRISRPGLRIYSNSQRIPRILGGMGIVILST 110 Query: 49 SRGIMTDREARLEGIG 2 SRGIMTDREARLEGIG Sbjct: 111 SRGIMTDREARLEGIG 126 >gb|ADD29864.1| ribosomal protein S8 [Antirrhinum majus] Length = 134 Score = 138 bits (347), Expect = 5e-31 Identities = 70/76 (92%), Positives = 74/76 (97%) Frame = -2 Query: 229 KKNKNFLVLTLRHRRNRKRPHPYRNFLNLKRISRPGLRIYSNSQRIPRILGGMGVVILST 50 +KNK+FLVLTLRHRRNRKRP YRNFLNLKRISRPGLRIYSNSQRIPRILGG+G+VILST Sbjct: 53 EKNKSFLVLTLRHRRNRKRP--YRNFLNLKRISRPGLRIYSNSQRIPRILGGIGIVILST 110 Query: 49 SRGIMTDREARLEGIG 2 SRGIMTDREARLEGIG Sbjct: 111 SRGIMTDREARLEGIG 126 >ref|YP_004935702.1| rps8 gene product (chloroplast) [Sesamum indicum] gi|347448331|gb|AEO92742.1| ribosomal protein S8 (chloroplast) [Sesamum indicum] Length = 134 Score = 137 bits (345), Expect = 9e-31 Identities = 70/77 (90%), Positives = 73/77 (94%) Frame = -2 Query: 232 EKKNKNFLVLTLRHRRNRKRPHPYRNFLNLKRISRPGLRIYSNSQRIPRILGGMGVVILS 53 ++KNK FLVLTLRHRRNRKRP YRNFLNLKRISRPGLRIY NSQRIPRILGGMG+VILS Sbjct: 52 QEKNKYFLVLTLRHRRNRKRP--YRNFLNLKRISRPGLRIYCNSQRIPRILGGMGIVILS 109 Query: 52 TSRGIMTDREARLEGIG 2 TSRGIMTDREARLEGIG Sbjct: 110 TSRGIMTDREARLEGIG 126 >gb|ABI15138.1| ribosomal protein S8 (chloroplast) [Gratiola virginiana] Length = 134 Score = 135 bits (339), Expect = 5e-30 Identities = 69/77 (89%), Positives = 73/77 (94%) Frame = -2 Query: 232 EKKNKNFLVLTLRHRRNRKRPHPYRNFLNLKRISRPGLRIYSNSQRIPRILGGMGVVILS 53 ++KNK FLVLTLRHRRNRKRP YRN LNLKRISRPGLRIYSNSQRIPRILGGMG+VILS Sbjct: 52 QEKNKYFLVLTLRHRRNRKRP--YRNVLNLKRISRPGLRIYSNSQRIPRILGGMGIVILS 109 Query: 52 TSRGIMTDREARLEGIG 2 TS+GIMTDREARLEGIG Sbjct: 110 TSQGIMTDREARLEGIG 126