BLASTX nr result
ID: Scutellaria23_contig00014542
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00014542 (228 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003577703.1| PREDICTED: uncharacterized hydrolase HI_0588... 61 8e-08 dbj|BAJ96433.1| predicted protein [Hordeum vulgare subsp. vulgare] 61 8e-08 ref|XP_003590793.1| N-carbamoyl-L-amino acid hydrolase [Medicago... 60 2e-07 gb|ABA99240.2| amidase, hydantoinase/carbamoylase family protein... 60 2e-07 gb|ABA99241.2| amidase, hydantoinase/carbamoylase family protein... 60 2e-07 >ref|XP_003577703.1| PREDICTED: uncharacterized hydrolase HI_0588-like [Brachypodium distachyon] Length = 464 Score = 61.2 bits (147), Expect = 8e-08 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = +1 Query: 115 LRGLT*ISKLNRSGFKPKRSLEVIMFTSEEPTRFGISC 228 L L IS L RSGF+PKRSLEVIMFTSEEPTRFGISC Sbjct: 145 LGALEAISVLKRSGFQPKRSLEVIMFTSEEPTRFGISC 182 >dbj|BAJ96433.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 328 Score = 61.2 bits (147), Expect = 8e-08 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = +1 Query: 115 LRGLT*ISKLNRSGFKPKRSLEVIMFTSEEPTRFGISC 228 L L IS L RSGF+PKRSLEVIMFTSEEPTRFGISC Sbjct: 146 LGALEAISVLQRSGFQPKRSLEVIMFTSEEPTRFGISC 183 >ref|XP_003590793.1| N-carbamoyl-L-amino acid hydrolase [Medicago truncatula] gi|355479841|gb|AES61044.1| N-carbamoyl-L-amino acid hydrolase [Medicago truncatula] Length = 499 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +1 Query: 133 ISKLNRSGFKPKRSLEVIMFTSEEPTRFGISC 228 + L+RSGFKPKRSLEVI+FTSEEPTRFGISC Sbjct: 159 LKSLHRSGFKPKRSLEVILFTSEEPTRFGISC 190 >gb|ABA99240.2| amidase, hydantoinase/carbamoylase family protein, expressed [Oryza sativa Japonica Group] gi|218187183|gb|EEC69610.1| hypothetical protein OsI_38984 [Oryza sativa Indica Group] Length = 484 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = +1 Query: 115 LRGLT*ISKLNRSGFKPKRSLEVIMFTSEEPTRFGISC 228 L L I L RSGF+PKRSLEVIMFTSEEPTRFGISC Sbjct: 165 LGALEAIRMLKRSGFQPKRSLEVIMFTSEEPTRFGISC 202 >gb|ABA99241.2| amidase, hydantoinase/carbamoylase family protein, expressed [Oryza sativa Japonica Group] Length = 371 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = +1 Query: 115 LRGLT*ISKLNRSGFKPKRSLEVIMFTSEEPTRFGISC 228 L L I L RSGF+PKRSLEVIMFTSEEPTRFGISC Sbjct: 52 LGALEAIRMLKRSGFQPKRSLEVIMFTSEEPTRFGISC 89