BLASTX nr result
ID: Scutellaria23_contig00014411
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00014411 (233 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001031844.1| thioredoxin-like 3-1 [Arabidopsis thaliana] ... 65 8e-09 ref|NP_568172.1| thioredoxin-like 3-1 [Arabidopsis thaliana] gi|... 65 8e-09 dbj|BAB09803.1| thioredoxin-like [Arabidopsis thaliana] 65 8e-09 gb|AFH68079.1| thioredoxin-like protein 2.1 [Populus tremula x P... 65 8e-09 ref|XP_002873272.1| hypothetical protein ARALYDRAFT_487479 [Arab... 65 8e-09 >ref|NP_001031844.1| thioredoxin-like 3-1 [Arabidopsis thaliana] gi|332003668|gb|AED91051.1| thioredoxin-like 3-1 [Arabidopsis thaliana] Length = 214 Score = 64.7 bits (156), Expect = 8e-09 Identities = 33/77 (42%), Positives = 42/77 (54%) Frame = +1 Query: 1 LDNAKQLSQPILVDWLIISTYTFTLFGINVLCSLIMYVC*SLSLSRMAKWCRKCIYLKPK 180 L +A+QLSQPI+++W MA WCRKCIYLKPK Sbjct: 111 LSHARQLSQPIIIEW-------------------------------MASWCRKCIYLKPK 139 Query: 181 LDKLAAEYDYKLKFYFV 231 L+KLAAEY+ + KFY+V Sbjct: 140 LEKLAAEYNNRAKFYYV 156 >ref|NP_568172.1| thioredoxin-like 3-1 [Arabidopsis thaliana] gi|298286899|sp|Q9FG36.3|TRL31_ARATH RecName: Full=Thioredoxin-like 3-1, chloroplastic; AltName: Full=Thioredoxin WCRKC-1; Flags: Precursor gi|117958721|gb|ABK59676.1| At5g06690 [Arabidopsis thaliana] gi|332003667|gb|AED91050.1| thioredoxin-like 3-1 [Arabidopsis thaliana] Length = 210 Score = 64.7 bits (156), Expect = 8e-09 Identities = 33/77 (42%), Positives = 42/77 (54%) Frame = +1 Query: 1 LDNAKQLSQPILVDWLIISTYTFTLFGINVLCSLIMYVC*SLSLSRMAKWCRKCIYLKPK 180 L +A+QLSQPI+++W MA WCRKCIYLKPK Sbjct: 111 LSHARQLSQPIIIEW-------------------------------MASWCRKCIYLKPK 139 Query: 181 LDKLAAEYDYKLKFYFV 231 L+KLAAEY+ + KFY+V Sbjct: 140 LEKLAAEYNNRAKFYYV 156 >dbj|BAB09803.1| thioredoxin-like [Arabidopsis thaliana] Length = 179 Score = 64.7 bits (156), Expect = 8e-09 Identities = 33/77 (42%), Positives = 42/77 (54%) Frame = +1 Query: 1 LDNAKQLSQPILVDWLIISTYTFTLFGINVLCSLIMYVC*SLSLSRMAKWCRKCIYLKPK 180 L +A+QLSQPI+++W MA WCRKCIYLKPK Sbjct: 86 LSHARQLSQPIIIEW-------------------------------MASWCRKCIYLKPK 114 Query: 181 LDKLAAEYDYKLKFYFV 231 L+KLAAEY+ + KFY+V Sbjct: 115 LEKLAAEYNNRAKFYYV 131 >gb|AFH68079.1| thioredoxin-like protein 2.1 [Populus tremula x Populus tremuloides] Length = 121 Score = 64.7 bits (156), Expect = 8e-09 Identities = 33/72 (45%), Positives = 39/72 (54%) Frame = +1 Query: 10 AKQLSQPILVDWLIISTYTFTLFGINVLCSLIMYVC*SLSLSRMAKWCRKCIYLKPKLDK 189 A++LSQPI++DW MA WCRKCIYLKPKL+K Sbjct: 25 ARELSQPIIIDW-------------------------------MASWCRKCIYLKPKLEK 53 Query: 190 LAAEYDYKLKFY 225 LAAEYD K+KFY Sbjct: 54 LAAEYDTKIKFY 65 >ref|XP_002873272.1| hypothetical protein ARALYDRAFT_487479 [Arabidopsis lyrata subsp. lyrata] gi|297319109|gb|EFH49531.1| hypothetical protein ARALYDRAFT_487479 [Arabidopsis lyrata subsp. lyrata] Length = 185 Score = 64.7 bits (156), Expect = 8e-09 Identities = 33/77 (42%), Positives = 42/77 (54%) Frame = +1 Query: 1 LDNAKQLSQPILVDWLIISTYTFTLFGINVLCSLIMYVC*SLSLSRMAKWCRKCIYLKPK 180 L +A+QLSQPI+++W MA WCRKCIYLKPK Sbjct: 86 LSHARQLSQPIIIEW-------------------------------MASWCRKCIYLKPK 114 Query: 181 LDKLAAEYDYKLKFYFV 231 L+KLAAEY+ + KFY+V Sbjct: 115 LEKLAAEYNNRAKFYYV 131