BLASTX nr result
ID: Scutellaria23_contig00014370
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00014370 (553 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631814.1| PREDICTED: E3 ubiquitin-protein ligase AIP2 ... 57 2e-06 ref|XP_002282370.1| PREDICTED: E3 ubiquitin-protein ligase AIP2 ... 57 2e-06 >ref|XP_003631814.1| PREDICTED: E3 ubiquitin-protein ligase AIP2 isoform 2 [Vitis vinifera] Length = 312 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/48 (52%), Positives = 41/48 (85%) Frame = +1 Query: 133 EEEVKERLQELQKQLGERHLFEDSVSNIRSLFLNHYSYTSLSLQRLVF 276 EE +K++LQELQKQLG++ +FE++V +I+SL ++HYS +S SL++L + Sbjct: 6 EENLKQQLQELQKQLGKKQMFEEAVLSIKSLLVDHYSSSSPSLRKLFY 53 >ref|XP_002282370.1| PREDICTED: E3 ubiquitin-protein ligase AIP2 isoform 1 [Vitis vinifera] Length = 317 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/48 (52%), Positives = 41/48 (85%) Frame = +1 Query: 133 EEEVKERLQELQKQLGERHLFEDSVSNIRSLFLNHYSYTSLSLQRLVF 276 EE +K++LQELQKQLG++ +FE++V +I+SL ++HYS +S SL++L + Sbjct: 6 EENLKQQLQELQKQLGKKQMFEEAVLSIKSLLVDHYSSSSPSLRKLFY 53