BLASTX nr result
ID: Scutellaria23_contig00014367
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00014367 (347 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281626.1| PREDICTED: transcription factor UNE12 [Vitis... 57 2e-06 >ref|XP_002281626.1| PREDICTED: transcription factor UNE12 [Vitis vinifera] gi|297735488|emb|CBI17928.3| unnamed protein product [Vitis vinifera] Length = 289 Score = 56.6 bits (135), Expect = 2e-06 Identities = 31/47 (65%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = +2 Query: 209 MANNPGEAPSDDFLEQILGFPSYATGDEANLAGNDSTPAA-MMLQLG 346 MA+NP EAP+DDFLEQILG P+Y D NLA ND AA M+LQLG Sbjct: 1 MASNPSEAPADDFLEQILGIPTYPAAD-PNLAANDVNLAAPMVLQLG 46