BLASTX nr result
ID: Scutellaria23_contig00014176
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00014176 (284 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002305133.1| predicted protein [Populus trichocarpa] gi|1... 61 1e-07 ref|XP_002531718.1| conserved hypothetical protein [Ricinus comm... 60 1e-07 ref|XP_002509471.1| conserved hypothetical protein [Ricinus comm... 59 4e-07 ref|XP_002263054.1| PREDICTED: uncharacterized protein LOC100256... 59 5e-07 gb|AFK41697.1| unknown [Medicago truncatula] 58 9e-07 >ref|XP_002305133.1| predicted protein [Populus trichocarpa] gi|118484061|gb|ABK93916.1| unknown [Populus trichocarpa] gi|222848097|gb|EEE85644.1| predicted protein [Populus trichocarpa] Length = 143 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -2 Query: 283 EVLGHDWLRLFFGDIVLGLSWVFFLVYSWREKYD 182 EVL DWLR GDI+LGLSWV FLVYSWREKYD Sbjct: 110 EVLAWDWLRQTVGDILLGLSWVLFLVYSWREKYD 143 >ref|XP_002531718.1| conserved hypothetical protein [Ricinus communis] gi|223528661|gb|EEF30677.1| conserved hypothetical protein [Ricinus communis] Length = 70 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = -2 Query: 283 EVLGHDWLRLFFGDIVLGLSWVFFLVYSWREKYD 182 E L HD RL GDIVLGLSWVFFLVYSWREKYD Sbjct: 37 EDLAHDLPRLVVGDIVLGLSWVFFLVYSWREKYD 70 >ref|XP_002509471.1| conserved hypothetical protein [Ricinus communis] gi|223549370|gb|EEF50858.1| conserved hypothetical protein [Ricinus communis] Length = 145 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -2 Query: 283 EVLGHDWLRLFFGDIVLGLSWVFFLVYSWREKYD 182 +VL DWLR GD +L LSWVFFLVYSWREKYD Sbjct: 112 DVLAWDWLRQIVGDFLLALSWVFFLVYSWREKYD 145 >ref|XP_002263054.1| PREDICTED: uncharacterized protein LOC100256771 [Vitis vinifera] gi|297735997|emb|CBI23971.3| unnamed protein product [Vitis vinifera] Length = 150 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -2 Query: 283 EVLGHDWLRLFFGDIVLGLSWVFFLVYSWREKYD 182 E L DWLR GDI+L LSWVFFLVYSWREKYD Sbjct: 117 EDLALDWLRQIVGDILLALSWVFFLVYSWREKYD 150 >gb|AFK41697.1| unknown [Medicago truncatula] Length = 145 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -2 Query: 283 EVLGHDWLRLFFGDIVLGLSWVFFLVYSWREKYD 182 E L DWLR GD++L LSWVFFLVYSWREKYD Sbjct: 112 EDLAWDWLRQTVGDVLLALSWVFFLVYSWREKYD 145