BLASTX nr result
ID: Scutellaria23_contig00014079
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00014079 (558 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524925.1| fad oxidoreductase, putative [Ricinus commun... 73 3e-11 ref|XP_003632497.1| PREDICTED: putative oxidoreductase C1F5.03c-... 72 8e-11 ref|XP_002283580.1| PREDICTED: putative oxidoreductase C1F5.03c-... 72 8e-11 ref|XP_002306237.1| predicted protein [Populus trichocarpa] gi|2... 72 8e-11 emb|CAN59806.1| hypothetical protein VITISV_038878 [Vitis vinifera] 71 1e-10 >ref|XP_002524925.1| fad oxidoreductase, putative [Ricinus communis] gi|223535760|gb|EEF37422.1| fad oxidoreductase, putative [Ricinus communis] Length = 276 Score = 73.2 bits (178), Expect = 3e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -3 Query: 199 FLALDWCDGGAVSSLARASFDLHRTLAQELNGSELYGYR 83 FLALDWCDGG +SSLAR SF+LHR+L+QELNG+ELYGYR Sbjct: 91 FLALDWCDGGPLSSLARTSFNLHRSLSQELNGAELYGYR 129 >ref|XP_003632497.1| PREDICTED: putative oxidoreductase C1F5.03c-like isoform 2 [Vitis vinifera] Length = 364 Score = 71.6 bits (174), Expect = 8e-11 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -3 Query: 199 FLALDWCDGGAVSSLARASFDLHRTLAQELNGSELYGYRP 80 FLA DWCDGGAVS LARASF+LHR+LAQEL+G YGYRP Sbjct: 90 FLAFDWCDGGAVSKLARASFNLHRSLAQELDGPRSYGYRP 129 >ref|XP_002283580.1| PREDICTED: putative oxidoreductase C1F5.03c-like isoform 1 [Vitis vinifera] Length = 420 Score = 71.6 bits (174), Expect = 8e-11 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -3 Query: 199 FLALDWCDGGAVSSLARASFDLHRTLAQELNGSELYGYRP 80 FLA DWCDGGAVS LARASF+LHR+LAQEL+G YGYRP Sbjct: 90 FLAFDWCDGGAVSKLARASFNLHRSLAQELDGPRSYGYRP 129 >ref|XP_002306237.1| predicted protein [Populus trichocarpa] gi|222855686|gb|EEE93233.1| predicted protein [Populus trichocarpa] Length = 378 Score = 71.6 bits (174), Expect = 8e-11 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = -3 Query: 199 FLALDWCDGGAVSSLARASFDLHRTLAQELNGSELYGYRP 80 FLALDWCD G +SSLARASF+LHR+L++ELNG+E YGYRP Sbjct: 50 FLALDWCDSGPLSSLARASFNLHRSLSEELNGTESYGYRP 89 >emb|CAN59806.1| hypothetical protein VITISV_038878 [Vitis vinifera] Length = 420 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -3 Query: 199 FLALDWCDGGAVSSLARASFDLHRTLAQELNGSELYGYRP 80 FLA DWCDGGAVS LARASF+LHR+LAQEL+G YGYRP Sbjct: 90 FLAFDWCDGGAVSXLARASFNLHRSLAQELDGPRSYGYRP 129